Detailed information on CNT3011150


BLAST search results

BLAST vs Swiss-Prot:
sp|O65101|PSAH_MAIZE, E-value = 3e-40

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673198Zea maysSetaria viridis13.7150.8897.41116forward
CNT30532753Zea maysEucalyptus grandis8.1627.8285.5169forward
CNT30591852Zea maysMusa acuminata12.5325.4287.74106forward
CNT30435366Zea maysAegilops tauschii12.7723.7487.04108forward
CNT30241486Zea maysAvena sativa12.7729.1988.89108forward
CNT30655703Zea maysTriticum dicoccoides12.7730.0887.04108forward
CNT30131217Zea maysLolium perenne12.7721.6490.74108forward
CNT30679604Zea maysTriticum urartu12.7732.1487.04108forward
CNT30338869Zea maysEragrostis tef10.7623.0487.9191forward
CNT30367799Zea maysSorghum bicolor28.0136.4185.65237forward
CNT30704201Zea maysPrunus avium12.7741.782.41108forward
CNT30149479Zea maysBrachypodium distachyon11.725.7185.8699forward
CNT30496573Zea maysDigitaria exilis32.0349.8285.98271forward
CNT30604128Zea maysOryza punctata9.8128.6295.1883forward

Expression of CNT3011150

Peptides detected in this lncRNA

>peptide 1 (71 aa)
MAPVAGCRARARQSRRGPTVRWCCRCRRGQSRRSCRRTWPPRRLRGACGWSGPTAWRRRASFRRWSCRRDP*

>peptide 2 (42 aa)
MTIATDRPALAVQSKLLDHANGEAELRSCRAGPAAAAPEVPS*

>peptide 3 (30 aa)
MQMEKLSLDLAARARLRRLLRSLLDRQEVR*

>peptide 4 (40 aa)
MERADGLATASFLPEMELPARPLMATGFTETAAREAMAAS*

>peptide 5 (37 aa)
FPFFIATQRHFNYCMYAKEYTIAEWQIYQIMNSVTTR*

Sequence

>CNT3011150
TTTTTCCTTTTTTCATAGCCACGCAACGCCATTTTAATTATTGTATGTATGCCAAAGAGTACACAATAGCGGAATGGCAAATATACCAAATTATGAACAG
CGTAACAACAAGATAGAGAGATGATCCATGACGATTGCGACGGATCGACCGGCGCTAGCAGTACAAAGCAAGCTACTAGACCATGCAAATGGAGAAGCTG
AGCTTAGATCTTGCCGCGCGGGCCCGGCTGCGGCGGCTCCTGAGGTCCCTTCTTGATCGGCAGGAGGTCCGGTGACGCCGACGCGCTGACGTAGGAACTT
GAGCAGCAGACCTCTCTTGGTGAACGGAGCCGCGAACGTCTCGAAGAACTTGCTCTGGTGACGTGAAGAACGCATGCAGCAGAGAGATCAGATCACCCTA
GCAAGTCTAGTTACCGCAGGGAATTGAATGGGTTGGAAACATCATGGCACCTGTAGCGGGTTGTAGGGCGAGGGCGCGTCAGAGCCGTAGAGGTCCCACT
GTCCGGTGGTGTTGCCGATGTCGTCGAGGTCAAAGTAGACGCTCTTGTCGCCGTACTTGGCCACCACGGCGGCTGCGCGGGGCCTGCGGATGGAGCGGGC
CGACGGCCTGGCGACGGCGAGCTTCCTTCCGGAGATGGAGCTGCCGGCGAGACCCTTGATGGCCACGGGCTTCACGGAGACGGCGGCGAGGGAGGCCATG
GCGGCTAGCTAAGCAAGCTTGACGCGCGCACTGGACAGTGGCGCTGTTGGGGGTTGCTGGTGTCCCGGTGCGTGCGTACGTGCACGAACTTAATTCGGCG
GATCGTATCGTGCTGAGGATTTGGGATTTGTGTGGGTGGACGCCTC