Detailed information on CNT3010486


BLAST search results

BLAST vs Swiss-Prot:
sp|O65101|PSAH_MAIZE, E-value = 4e-35

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693708Zea maysOryza sativa13.4122.2689.34122forward
CNT30285918Zea maysTriticum aestivum11.4322.1385.58104forward
CNT30101676Zea maysOryza rufipogon9.7820.9989.8989forward
CNT30116867Zea maysOryza nivara8.7933.291.2580forward

Expression of CNT3010486

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MQMEKLSLDLAARARLRRLLRSGDADALT*

>peptide 2 (40 aa)
MERADGLATASFLPEMELPARPLMATGFTETAAREAMAAS*

>peptide 3 (41 aa)
MTIATDRPALAVQSKLLDHANGEAELRSCRAGPAAAAPEVR*

>peptide 4 (56 aa)
VSTIKLPILYVLESSGYVKVNYMRATQRHFNYCMYAKEYTIAEWQIYQIMNSVTTR*

>peptide 5 (71 aa)
MAPVAGCRARARQSRRGPTVRWCCRCRRGQSRRSCRRTWPPRRLRGACGWSGPTAWRRRASFRRWSCRRDP*

Sequence

>CNT3010486
TAGTATCTACAATAAAGTTGCCCATACTATACGTACTTGAGTCTTCAGGTTATGTGAAGGTTAATTATATGAGAGCCACGCAACGCCATTTTAATTATTG
TATGTATGCCAAAGAGTACACAATAGCGGAATGGCAAATATACCAAATTATGAACAGCGTAACAACAAGATAGAGAGATGATCCATGACGATTGCGACGG
ATCGACCGGCGCTAGCAGTACAAAGCAAGCTACTAGACCATGCAAATGGAGAAGCTGAGCTTAGATCTTGCCGCGCGGGCCCGGCTGCGGCGGCTCCTGA
GGTCCGGTGACGCCGACGCGCTGACGTAGGCCAGAAGTGAGCCGCCGCCCAGCAGCAGGAACTTGAGCAGCAGACCTCTCTTGGTGAACGGAGCCGCGAA
CGTCTCGAAGAACTTGCTCTGGTGACGTGAAGAACGCATGCAGCAGAGAGATCAGATCACCCTAGCAAGTCTAGTTACCGCAGGGAATTGAATGGGTTGG
AAACATCATGGCACCTGTAGCGGGTTGTAGGGCGAGGGCGCGTCAGAGCCGTAGAGGTCCCACTGTCCGGTGGTGTTGCCGATGTCGTCGAGGTCAAAGT
AGACGCTCTTGTCGCCGTACTTGGCCACCACGGCGGCTGCGCGGGGCCTGCGGATGGAGCGGGCCGACGGCCTGGCGACGGCGAGCTTCCTTCCGGAGAT
GGAGCTGCCGGCGAGACCCTTGATGGCCACGGGCTTCACGGAGACGGCGGCGAGGGAGGCCATGGCGGCTAGCTAAGCAAGCTTGACGCGCGCACTGGAC
AGTGGCGCTGTTGGGGGTTGCTGGTGTCCCGGTGCGTGCGTACGTGCACGAACTTAATTCGGCGGATCGTATCGTGCTGAGGATTTGGGATTTGTGTGGG
TGGACGCCTC