Detailed information on CNT30104764


BLAST search results

BLAST vs Swiss-Prot:
sp|Q2QLY5|METE1_ORYSJ, E-value = 5e-32

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30282Oryza rufipogonZea mays34.8330.5986.0293forward
CNT30619828Oryza rufipogonCajanus cajan29.9622.18580forward
CNT30118059Oryza rufipogonOryza nivara101.8792.8395.22272forward

Expression of CNT30104764

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MLRPSTTPAKRYFPEGKPALLIRSRVLAPRIRSKP*

>peptide 2 (88 aa)
VSEVCLNKHIQSRKCRLEFCVRCRECGQLVRVKGSERCSEIISPDVASIHNTGKEVLSRGETSTLDKVKSLGSTDKVKTISSHAVQGCE

>peptide 3 (29 aa)
SAKYVSISTFNPESADSSSVYAAENAANW*

Sequence

>CNT30104764
GTCAGCGAAGTATGTCTCAATAAGCACATTCAATCCAGAAAGTGCCGACTCGAGTTCTGTGTACGCTGCAGAGAATGCGGCCAATTGGTGAGAGTCAAGG
GTAGTGAGAGATGCAGCGAGATCATCAGCCCAGATGTTGCGTCCATCCACAACACCGGCAAAGAGGTACTTTCCAGAGGGGAAACCAGCACTCTTGATAA
GGTCAAGAGTCTTGGCTCCACGGATAAGGTCAAAACCATAAGCAGTCACGCTGTTCAGGGATGTGAG