Detailed information on CNT30104724


BLAST search results

BLAST vs Swiss-Prot:
sp|P29766|RL8_SOLLC, E-value = 1e-66

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30546122Oryza rufipogonIpomoea triloba9.3927.8486.7398forward
CNT3086243Oryza rufipogonVigna radiata18.9744.385.35198forward
CNT30555589Oryza rufipogonOryza glaberrima67.4340.3498.72704forward
CNT30146667Oryza rufipogonMedicago truncatula7.6628.3783.7580forward
CNT30440942Oryza rufipogonAegilops tauschii12.0758.0693.65126forward
CNT30338628Oryza rufipogonEragrostis tef28.9385.0794.37302forward
CNT30367313Oryza rufipogonSorghum bicolor22.1340.6793.94231forward
CNT30646608Oryza rufipogonCannabis sativa21.5548.2883.11225forward
CNT30578506Oryza rufipogonOryza barthii98.8564.9196.91032forward
CNT30117466Oryza rufipogonOryza nivara67.4363.0399.29704forward

Expression of CNT30104724

Peptides detected in this lncRNA

>peptide 1 (49 aa)
MHRQTISSTYATTILMVEQMESIHGQQYQVVHIQLYYNDRKNSRIIEQN*

>peptide 2 (35 aa)
QGHLSNRSKHADQTRRICKGLSSMLAYIHHLIAKS*

Sequence

>CNT30104724
GCCAAGGACATCTCTCCAACAGAAGCAAGCATGCGGATCAAACAAGGCGCATATGTAAAGGATTATCTTCTATGTTAGCATACATACATCACTTGATAGC
AAAATCATAAGCATAAACATAATTCACCACTTGAAAGAGCGAATTGGCCAATCATATTAATCATGCATAGACAAACAATATCTAGTACATATGCCACCAC
AATCTTGATGGTAGAACAAATGGAAAGCATCCATGGGCAACAATATCAAGTAGTGCATATACAACTATATTATAACGATAGAAAAAACAGCAGGATTATT
GAACAAAACTAGTTGTTTGTGGTGCTCTATTACACAGTATCAACAGAAGCAAATGTTCGAAAATACACTAAAGTAGCTACATCCAAGGCATTCGAATCAT
CTCTAAACAAATGGCACATATATTTACTTTGGGTCTCTACTAAATAACAAATAATTAAAGCAACATTAAATCGCATCATCCATATTTAGATTGAGCCGAG
ATCATTTCCAATAGATGAGTTCTTCTAATCACGCGAACAAATCAATTCAGATCCAATAATAGTAGTTACTACCACACAACTACGAGACTAACAAACAGAT
CTAACACAAAACATCTCATCAATTCAGGCAAAAAAAAGAAGAAGCGAGAGAGATGGGGATCACCTGGATGTGCCGTTATCGGGGTTGTGGCTGATGACGA
TGGCCACGTTGCCGATGGAGAGCGTGGCGCGGCGGCCGCAGTAGACGAACTGCCCCGTGTACATCCCCTCCGCCGCGACGAACAGCTCCTTCTGGTGCTT
GTACCGGAACGGGTGGCGGAACGTCACCTTGGCGAGCGGCGCGCCGCGGCCGGGGTCGTGGATGATGTCGGTGACGACGCCCTTGAGGTAGCCGTTGCGC
TCGCCGAAGTCGAGGGAGCGGAACCTCGCGGGGCCCTTGCGGTGGTGGGTGTGGGACTTGAACACGGAGCCCGCACCCTTACGCTGCGCGCGGATCACGC
GACCCATCTCCTCGTCGGCGGCGAGACGGCGGGGGTGGCTAGGG