Detailed information on CNT30104639


BLAST search results

BLAST vs Swiss-Prot:
sp|Q36284|NU5M_MAIZE, E-value = 7e-88

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30197509Oryza rufipogonPisum sativum57.2927.6494.28629forward
CNT30182368Oryza rufipogonSecale cereale91.849.796.831008forward
CNT30299594Oryza rufipogonTriticum aestivum40.8959.3999.33449forward
CNT30221864Oryza rufipogonHordeum vulgare53.8329.1199.32591forward
CNT30385170Oryza rufipogonTriticum turgidum91.7171.5796.231007forward
CNT30586133Oryza rufipogonMusa acuminata67.4933.5187.04741forward
CNT30147395Oryza rufipogonMedicago truncatula57.2914.894.28629forward
CNT30468144Oryza rufipogonSaccharum spontaneum100.5539.2398.011104forward
CNT30210175Oryza rufipogonHelianthus annuus22.0464.3695.04242forward
CNT30627916Oryza rufipogonDaucus carota57.0117.3595.05626forward
CNT30427311Oryza rufipogonPapaver somniferum46.9914.0194.96516forward
CNT30574574Oryza rufipogonVitis vinifera55.9218.2495.11614forward
CNT3056795Oryza rufipogonAmborella trichopoda26.4154.5192.41290forward
CNT30115468Oryza rufipogonOryza nivara90.1628.68100990forward

Expression of CNT30104639

Peptides detected in this lncRNA

>peptide 1 (90 aa)
MVGAANSDSARISFFGSTKGELAQKLDRGKDAAGGRRLIQVPPEPREMVAYYTAHKLCLGWGYLLFVGGTYGARRASVCCVDCLCISYRV*

>peptide 2 (52 aa)
MHFLQSVMEPSSAPPSQKERKEQNSRRRRVEYSQGAFVVRKGPNGRPCSEVH*

>peptide 3 (29 aa)
PRVRRVGFPVYPQRRSRPHQPKQVGGHGS*

Sequence

>CNT30104639
CCTCGGGTTCGTAGAGTCGGGTTTCCCGTTTACCCACAACGGAGGAGCCGCCCCCACCAACCAAAGCAGGTAGGCGGCCACGGTTCATAACGCACTCTTC
GCACAACAGATCCACTTTGAAGTTGACTTATTCGCTCGGCCAATCGTCGGAATGTGTACGAGATACCATAAGGGCCCAATATCTCAATAGCACCCTTGTC
TAAAGCTTCGAATGAGACTGAATATCCGAAACGCAGGAACGATCTGACTAGAAAGTCATTCAAAACTTGATCGAAGAACCAGCGTTTATTGAAGAAGCTA
TAGAGTCGATTACAAAAAGTACTAGTTTGAAAGGCTCGTTGGAATTGATCCGCTACGAGATTGACATTATACGCTAGAGAAGCACCTGAAGTACTAAACA
GAATAGGTATTAGTTTTGTAATGGTTGGAGCAGCAAACTCGGATTCGGCAAGAATCTCATTTTTTGGTAGTACGAAGGGGGAATTGGCCCAAAAATTGGA
TAGGGGTAAAGACGCAGCCGGGGGCCGGCGGCTTATTCAAGTGCCCCCCGAACCGCGCGAAATGGTCGCCTATTACACGGCTCACAAACTCTGCCTGGGG
TGGGGCTACCTATTATTCGTAGGCGGTACGTACGGCGCACGCAGGGCCTCGGTTTGCTGCGTGGACTGTCTATGCATTTCCTACAGAGTGTAATGGAACC
CAGCTCAGCTCCGCCGAGCCAAAAGGAAAGAAAAGAACAGAACAGCCGGAGGCGAAGAGTAGAGTATAGCCAAGGGGCTTTCGTCGTCCGTAAAGGACCT
AACGGAAGACCGTGCTCCGAAGTGCACTGAGAGTTTTGTTTTAAGAACACTTGGCCTTACCCCTTCGTTTTGAGCCATGTAATCGGCAAGATTGAACCGA
GGCCCGCCCGGGCACCGCCGGGGGGACAACCAGTAGGCTTTCTTTCCGAAGTTTCCTCCCGGGGCCCTTAAATCATTGAATTCATAGGCATAAGGGCGTC
CCAGGCAGTGGTTCATTCAATGAGAAAGAAAGACAGGAGGGCAGGATTCGTCGCGTCGGGCGAATTCATTCTGGGAAAAAAGGGGGAAGGGAGTCACC