Detailed information on CNT30104637


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697886Oryza rufipogonOryza sativa68.8856.2594.32405forward
CNT30597173Oryza rufipogonOryza meridionalis84.5298.4299.6497forward
CNT30371519Oryza rufipogonOryza glumipatula65.1410098.96383forward
CNT30578440Oryza rufipogonOryza barthii97.1197.1199.47571forward
CNT30117979Oryza rufipogonOryza nivara67.8697.3299.25399forward

Expression of CNT30104637

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MIQEKEIQPCEYVTSIINLAYIYSKYLRACSPVTISLHVVNISIISLPDM*

>peptide 2 (76 aa)
SLCLADLLLIVFLRSLAGSPLPGGRRRRWMLVGFTGSHSVRGSPFSQRQATIHGGEVFQAACSAPLLEVSVLFYED*

>peptide 3 (38 aa)
MLTSHYFTSCCEHQYYQSTRYVRSEFFLLLSTLLCQND*

>peptide 4 (31 aa)
FLSASRICSSSSFSALSPVHRYPAVAGGDGC*

>peptide 5 (74 aa)
FSLPRGFAPHRLSPLSRRFTATRRSPAEMDASWIHREPFSPRLSLQPTASDDPRRRSISGGLLCSPVGSFSSVL*

Sequence

>CNT30104637
TTTCTCTCTGCCTCGCGGATTTGCTCCTCATCGTCTTTCTCCGCTCTCTCGCCGGTTCACCGCTACCCGGCGGTCGCCGGCGGAGATGGATGCTAGTTGG
ATTCACCGGGAGCCATTCAGTCCGCGGCTCTCCCTTCAGCCAACGGCAAGCGACGATCCACGGCGGCGAAGTATTTCAGGCGGCCTGCTCTGCTCCCCTG
TTGGAAGTTTCAGTTCTGTTTTATGAAGATTAGAAATTTCAGTTTATGATCCAGGAAAAGGAAATCCAGCCATGTGAGTATGTGACTTCAATTATAAATT
TAGCTTATATTTATTCGAAATATCTGAGGGCATGCTCACCAGTCACTATTTCACTTCATGTTGTGAACATCAGTATTATCAGTCTACCAGATATGTAAGA
TCAGAGTTTTTTTTGCTTCTCTCTACTTTGCTATGTCAGAATGATTAGGAAATGTCAAAATTGATTTTGAAGAAACAAACGGATGGTTCACTTTTACAGC
CTCTTCTTTTCACTTATACTTATGCTTATATTTATTAGCCAAAATTTGAATTTTCAACTTTAAATTTGGAGTTAATTTTGAGGTTTTT