Detailed information on CNT30104624


BLAST search results

BLAST vs Swiss-Prot:
sp|P18566|RBS2_ORYSJ, E-value = 3e-41

BLAST vs NONCODE:
NONORUT002193, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555604Oryza rufipogonOryza glaberrima87.6569.1798.16653forward
CNT30371385Oryza rufipogonOryza glumipatula85.198.9196.21634forward
CNT30578557Oryza rufipogonOryza barthii89.456.6398.2666forward
CNT30118102Oryza rufipogonOryza nivara71.2846.7899.06531forward

Expression of CNT30104624

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MPHPTTYSRSRYHSYIKSERDQVKQKQKQSTAGKIKRR*

>peptide 2 (33 aa)
EHNNYICFLVNSVWKSTNQYRKAFPMNNRSMIF*

>peptide 3 (75 aa)
MKLMSCTCLTLSKPMIRTNASGYAFLASSSSLSTWVASVHPNMGSFHMVLHGERWQVGEGLELLDALNRPHLNKR*

Sequence

>CNT30104624
TGAACACAACAATTATATATGTTTTCTTGTGAATTCAGTTTGGAAATCCACTAATCAGTATAGAAAGGCATTTCCGATGAACAACAGAAGCATGATTTTT
TAATTCCATGATCAAATTTTCATTGTCGACGAATTGATTGTTGGACACATATGCTCTAGGATTCACATCCATCTCGTACCCTTTGTATAAATATATATAG
CCGGAGCTTCCATAGATTTCATTCACATATGCCTCACCCAACAACATATAGTCGTAGCAGATACCACTCTTACATCAAGTCAGAGAGAGATCAGGTGAAA
CAAAAACAAAAGCAGAGCACGGCCGGTAAAATCAAAAGACGATGAACAAACTGGGAACACACGAAACAAGGTGGGAGACATCATCGAATCAGAGATGAAC
AATTAAACAAGGCTATATATGACGATGACGGCTTAGTTGCCACCAGACTCCTCGCAGCCCGGGGGCTTGTAGGCGATGAAGCTGATGAGCTGCACCTGCC
TGACGTTGTCGAAGCCGATGATACGGACGAATGCATCAGGGTACGCCTTCTTGGCCTCCTCGAGCTCCTTGAGCACCTGGGTGGCGTCAGTGCACCCGAA
CATGGGCAGCTTCCACATGGTCCTCCACGGTGAGCGGTGGCAGGTAGGAGAGGGTCTCGAACTTCTTGATGCCCTCAATCGGCCACACCTAAATAAACGA
TAATTGAATTATTGGTTAATGTTGAAGAAGAAGAAGAAGAAGAAG