Detailed information on CNT30104607


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672414Oryza rufipogonSetaria viridis30.081895.37108forward
CNT30520781Oryza rufipogonSetaria italica30.0816.7795.37108forward
CNT30639966Oryza rufipogonNymphaea colorata22.015.2686.0879forward
CNT30533721Oryza rufipogonEucalyptus grandis25.6313.1888.0492forward
CNT30516978Oryza rufipogonJuglans regia29.2515.483.81105forward
CNT30698134Oryza rufipogonQuercus lobata29.255.6383.81105forward
CNT3021623Oryza rufipogonCitrullus lanatus30.368.0382.57109forward
CNT30730016Oryza rufipogonCorchorus capsularis28.9715.7181.73104forward
CNT30710011Oryza rufipogonGlycine max20.6117.1389.1974forward
CNT30182270Oryza rufipogonSecale cereale27.0217.5790.7297forward
CNT30294278Oryza rufipogonTriticum aestivum29.8124.8393.46107forward
CNT30222663Oryza rufipogonHordeum vulgare27.0219.1791.7597forward
CNT30390478Oryza rufipogonTriticum turgidum27.028.1490.7297forward
CNT30564215Oryza rufipogonActinidia chinensis19.7826.8985.9271forward
CNT30249726Oryza rufipogonAvena sativa29.5313.2290.57106forward
CNT30454500Oryza rufipogonSaccharum spontaneum30.0829.8391.67108forward
CNT30135064Oryza rufipogonLolium perenne27.0216.9993.8197forward
CNT3014188Oryza rufipogonZea mays30.0814.1495.37108forward
CNT30720963Oryza rufipogonTriticum spelta27.0217.4190.7297forward
CNT30344813Oryza rufipogonEragrostis tef30.0820.6592.59108forward
CNT30570425Oryza rufipogonVitis vinifera29.816.1684.11107forward
CNT3027985Oryza rufipogonTheobroma cacao28.9719.1582.69104forward
CNT3037519Oryza rufipogonCucumis melo24.798.6185.3989forward
CNT30578384Oryza rufipogonOryza barthii64.3558.93100231forward
CNT30582414Oryza rufipogonEchinochloa crusgalli30.0818.2495.37108forward
CNT30557050Oryza rufipogonPanicum hallii30.0828.4295.37108forward
CNT30551919Oryza rufipogonOryza brachyantha29.816.8794.39107forward

Expression of CNT30104607

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MNTHMFHHRSIYTCITRSCTYKQKIYLKKYGRSST*

>peptide 2 (74 aa)
MHFIYTSRRHSNQPPHEHTHVPSSIDLHMHHPVMHLQTKDLLEEVREVEHVEEEVGPEDAGDAAEEEAAGELGPA

Sequence

>CNT30104607
TGATTAATTATCATTGTTAAAACTTTTTCTTTCCATGTAAATTATCTGCAAAGTAAGAAAGTAACACTCCCAAGTTACAACAGCACACCATCCATATATC
CATGCAGGCAGCCTGTTTGTGCCCTTGTGCAGATGCATTTCATTTATACAAGTAGAAGGCACTCAAATCAGCCACCACATGAACACACACATGTTCCATC
ATCGATCGATCTACACATGCATCACCCGGTCATGCACTTACAAACAAAAGATCTACTTGAAGAAGTACGGGAGGTCGAGCACGTAGAGGAGGAAGTAGGC
CCAGAGGACGCCGGAGATGCCGCCGAAGAAGAAGCCGCCGGTGAACTTGGCCCAGCCGT