Detailed information on CNT30104583


BLAST search results

BLAST vs Swiss-Prot:
sp|Q2QLY5|METE1_ORYSJ, E-value = 1e-38

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672513Oryza rufipogonSetaria viridis26.8914.2591.2357forward
CNT30377828Oryza rufipogonArabidopsis thaliana22.1713.6293.6247forward
CNT30224666Oryza rufipogonHordeum vulgare47.1745.0589100forward
CNT30555741Oryza rufipogonOryza glaberrima10095.9399.53212forward
CNT30312681Oryza rufipogonCamelina sativa29.2520.4687.162forward
CNT30264857Oryza rufipogonBrassica rapa29.2520.688.7162forward
CNT30212158Oryza rufipogonHelianthus annuus40.5722.1183.7286forward
CNT30478263Oryza rufipogonArabidopsis halleri22.1713.5893.6247forward
CNT30367300Oryza rufipogonSorghum bicolor51.8924.3985.45110forward
CNT30597166Oryza rufipogonOryza meridionalis88.2166.3198.93187forward
CNT30105511Oryza rufipogonOryza longistaminata96.78298.54205forward
CNT3027096Oryza rufipogonPopulus trichocarpa49.0629.8983.65104forward
CNT30578422Oryza rufipogonOryza barthii97.6410099.52207forward
CNT30604899Oryza rufipogonOryza punctata97.1788.4198.06206forward
CNT30333329Oryza rufipogonCynara cardunculus44.8119.6384.2195forward

Expression of CNT30104583

Peptides detected in this lncRNA

>peptide 1 (69 aa)
LTLSNNSLKRLEGGERCGEIISPDVASIHNTSKEVLSRGETSTLDKVKSLGSTDKVKTISSHAVQGCEGP

>peptide 2 (58 aa)
LPFPTIASRDSRVVRDAARSSAQMLRPSTTPAKRYFPEGKPALLIRSRVLAPRIRSKP*

Sequence

>CNT30104583
GCTTACCCTTTCCAACAATAGCCTCAAGAGACTCGAGGGTGGTGAGAGATGCGGCGAGATCATCAGCCCAGATGTTGCGTCCATCCACAACACCAGCAAA
GAGGTACTTTCCAGAGGGGAAACCAGCACTCTTGATAAGGTCAAGAGTCTTGGCTCCACGGATAAGGTCAAAACCATAAGCAGTCACGCTGTTCAGGGAT
GTGAGGGTCCTG