Detailed information on CNT30104571


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002531, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30104571

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MSFASYYWVVTGCILLNLGVNFTRVNLASDEILMGHAKYKVMPPQGLL*

>peptide 2 (74 aa)
MDAYHDLSCTEVQYHPRLPVAEDLNSLQWGSYISFLLSCSMPNSWYVFCKLLLGSNRLHITKPWSKFYESKLGQ*

Sequence

>CNT30104571
AGGACAGATGGTTGACAACTTCTCAAATAAAGAACAGATAGTTAAGCATGGATGCCTATCATGACCTTTCGTGCACAGAAGTGCAATATCATCCAAGACT
GCCTGTTGCAGAGGATCTGAATTCGTTGCAATGGGGTTCCTATATTTCTTTCTTACTTTCGTGCTCAATGCCCAATAGTTGGTATGTCTTTTGCAAGTTA
CTATTGGGTAGTAACAGGCTGCATATTACTAAACCTTGGAGTAAATTTTACGAGAGTAAACTTGGCCAGTGATGAAATATTAATGGGACATGCAAAATAT
AAAGTTATGCCACCACAAGGTTTGCTCTAAATTTTACCTATGACTTTGTCTTTTTGAATACTTGCTGTAATTGGACCTACATGAAAAACTCTTAACCATA
GAATTGTTCTACAAATTCTCATGTATAGTGATATCCTTCTTTTCTATGTT