Detailed information on CNT30104550


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002447, E-value = 3e-148

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30104550

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MTRAYRYILQAKMRTLMINARVISIMQYLIAQLSAYLNLLRQ*

>peptide 2 (29 aa)
MALLCIGRTKPIANNKLFPAPSTLINSHPA

>peptide 3 (56 aa)
MRASSHKIFNLSKDLVFLPLPGYRLSQFKMLVRVTHICRFKPTELTCSFSSLRAMM*

>peptide 4 (69 aa)
MESSHLYINYAFLASVKNKEMQRKNRTITELFLSPNKQRIERTSAKVLARASVFLLKKMIQSDFIGILD*

>peptide 5 (84 aa)
MTLLKILRHDLLPFESKYQVSAIPIRPSPNVQYWQMTNDKSLPVHPPSQDADFNDKCQGYINHAIPNSPAISLSESSKTIKAFY*

>peptide 6 (43 aa)
SSTHGDLVELGEAVGVIAGQSIGEPGTIDTRISKSIIIDIFIE*

Sequence

>CNT30104550
GAGTTCCACTCATGGCGATCTGGTCGAATTGGGGGAAGCTGTAGGTGTTATTGCGGGTCAATCTATTGGGGAGCCAGGGACAATTGATACACGGATTTCC
AAATCTATAATTATAGACATATTCATAGAATGACTCTACTGAAGATATTGAGACACGACCTGCTCCCCTTCGAGTCCAAGTATCAGGTGAGCGCTATCCC
CATCCGGCCTTCACCAAATGTCCAGTATTGGCAAATGACAAATGACAAGAGCCTACCGGTACATCCTCCAAGCCAAGATGCGGACTTTAATGATAAATGC
CAGGGTTATATCAATCATGCAATACCTAATAGCCCAGCTATCAGCCTATCTGAATCTTCTAAGACAATAAAAGCCTTCTATTAGAGAATGAGAGCTTCTT
CACACAAGATCTTTAACTTAAGTAAGGACTTGGTTTTCTTACCACTGCCCGGCTACCGGCTTTCTCAATTCAAAATGCTAGTTCGCGTCACTCACATATG
CCGTTTTAAACCAACTGAGCTAACTTGCAGTTTTTCCAGTCTTCGAGCAATGATGTGAGACATACCTGTTTCCCTTACTAGAGCCGAGCAGTTGCCAGGC
CCGCGTCCTTCCCCAATTGGCAGGCACGATTGCAGTCCCATAAGGTCCTTGACCCCTACCTTTTTAGAGATTCATGGAATCATCACATCTATATATTAAT
TACGCATTTCTCGCTTCCGTTAAAAACAAGGAAATGCAACGAAAAAATAGGACGATTACGGAACTTTTTCTGTCCCCAAACAAGCAACGGATTGAGCGCA
CTAGCGCGAAAGTGTTAGCACGCGCATCCGTTTTCTTGCTCAAAAAAATGATTCAATCTGACTTTATCGGTATTCTTGATTGAGTAAAAAAGGGATATAT
GAAGTTCAAGGCCTTGCCAAAACCGTCATGGCCCTATTATGTATAGGCCGTACTAAGCCAATAGCGAATAACAAACTCTTTCCTGCTCCCTCGACCCTAA
TTAACTCCCATCCTGCC