Detailed information on CNT30104541


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697920Oryza rufipogonOryza sativa69.9466.3199.87754forward
CNT30590960Oryza rufipogonMusa acuminata15.2157.7582.32164forward
CNT30555734Oryza rufipogonOryza glaberrima18.2722.1698.98197forward
CNT30371520Oryza rufipogonOryza glumipatula23.4739.2999.21253forward
CNT30578423Oryza rufipogonOryza barthii73.0170.0890.85787forward
CNT30118000Oryza rufipogonOryza nivara79.7839.7692.21860forward
CNT30604894Oryza rufipogonOryza punctata24.7710.9988.76267forward

Expression of CNT30104541

Peptides detected in this lncRNA

>peptide 1 (36 aa)
APNPNIITHSLTQQYIATYHAIITHTSQNSPIMQEN*

>peptide 2 (61 aa)
RTQSQHNHSLTHTAIYSYVPCNNNTYLTKFTNNAGELINVIHHISWLPDDSHISIDNLFHW*

>peptide 3 (33 aa)
MMLNNNSLIYGDLYWYEYILLVNRKRNNCIIRS*

Sequence

>CNT30104541
CGCACCCAATCCCAACATAATCACTCACTCACTCACACAGCAATATATAGCTACGTACCATGCAATAATAACACATACCTCACAAAATTCACCAATAATG
CAGGAGAATTAATCAATGTAATCCACCATATTTCATGGCTCCCTGATGACAGCCACATTTCGATTGATAATTTATTCCATTGGTAGCTTGATCTTGATCG
ATCTTAGTGTACCCCATTGGTAGCTCCGTTTCCGGCGACGACGGCGGTGGAGCTCGTCGCGGGTGGTCTCGGCGCGCTTGAGGGCGGCGAGGACGTCGAC
GAGGGCGCGGGCGGCAGCGTAGACGGTGGTGAGGGGGGACTTGATGAGGTGGAACCCCATCTCCATGAGCTCCTGCCTCGTGTGCAGCGGCGTCTTCCCG
CCCTCCAGCATGTTGCACACGCGATAACCCTTGGTCCTCCTGCAGATCTCCATCAGCTCCTCGTCGCTCCGCGGCGCCTCCACGAAGCACGCGTCTGCTC
CCGCCTACAATTTTTTTTTTACATATATTCATATTAGATATGATATGATGTTGAATAATAATAGCTTAATTTACGGTGATCTCTACTGGTATGAATATAT
CCTACTAGTAAATAGGAAAAGAAATAATTGTATTATCCGTAGTTGAGGTACGTATAGTAATATAATTGATAGGATTTTATTTGATTAGAAGAAAATGAAC
GGTTTAGATTGGATTCTACAACCAGTAAAGACCAATGTAAAAACACCAATGGGTTAAATTCCATTATATAGGAGAAAAATATACCACAGACATTGTTTGT
GAGCCTAATATATAATAGAAGACAAAGATACAAACCATTTTCATTTCATCATGTAAAAAGAAAGTGTTTTCGCCTCACATATATCAGTTTTCAAAATGCA
ACTTTGACCAATATCTAATGAAAGAACTAATTAATTTCAAAACATTGATTCTTGACAGACTTGAACTTGTTTAAGATTTATAGTTGGTGGTTGAGATCGA
TCAAATTTAAACGAGAGTTTGACTCTGAAGAGATTCTCTAGAACATGATTTATCTCTCTCTAGAAAAAAGAAGTGGTC