Detailed information on CNT30104481


BLAST search results

BLAST vs Swiss-Prot:
sp|P00868|RBS1_PEA, E-value = 1e-32

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672859Oryza rufipogonSetaria viridis8.1929.692.4266forward
CNT30437365Oryza rufipogonAegilops tauschii17.4940.9986.52141forward
CNT30597219Oryza rufipogonOryza meridionalis56.9543.7699.13459forward
CNT30118016Oryza rufipogonOryza nivara56.9560.5599.13459forward
CNT30604884Oryza rufipogonOryza punctata56.8267.1693.23458forward

Expression of CNT30104481

Peptides detected in this lncRNA

>peptide 1 (59 aa)
MHLILPPLLTLPKLELLERRFTGRPAVDLSPWKGATEVADEAITVGAIASSLAFCLVRC*

>peptide 2 (67 aa)
LQNQNFIVDGFRYALGIILHEYVCIAGDLAFTCPVSPSPNDRPIVVVVLLQQRQFPHGPVPTVIVSG*

Sequence

>CNT30104481
TTTTGCAAAACCAAAATTTCATTGTCGACGGATTCAGATATGCTCTAGGCATCATATTACATGAGTACGTGTGTATAGCCGGAGATCTTGCATTCACGTG
CCCTGTCTCACCGTCACCGAACGATAGACCGATAGTTGTAGTAGTACTCTTGCAACAACGGCAGTTTCCACATGGTCCAGTACCTACCGTCATAGTATCC
GGGTGATCTGTGATTTTCACGGTAGACGAATCCGACCTTGCTGAACTCCAAGCAAGGCACCCACTTAGATCGGAGCAGGTACTCGATCTGCTTCAAAAGG
TCCTCCACTGTCAATGGCGGCAAGTACGACAGAGTCTCGAACTTCTTAATGCCCTCAATCGGCCACACCTGATTGAATGAATTGATGCAGATAATAGAAT
CGGGCCAACATTTAATATATATGAACAACGAGCACTTTGAAGGAGAAATTGAAACGTATCGTTTCTGATACCTGCATGCATCTGATCCTTCCGCCATTGC
TGACGTTGCCAAAGCTCGAGCTGCTGGAGCGGCGGTTCACCGGGAGGCCCGCAGTGGACTTGAGCCCCTGGAAGGGAGCCACGGAGGTGGCCGACGAGGC
CATCACGGTGGGCGCCATTGCTAGCTCTCTAGCTTTCTGCTTGGTGAGGTGCTAGAGCAGAGTCACGCTGCAGCAGTGGCTTGAGGACCTGTGTGGTAAT
CCATTACGTCTATAAATAACCAAATCGCAGGTGGCATTGGAAGGCAGCGCTTGGTTGATCCGGGGATGTGGAAAGAGTGGCTGCCGTTCGCTGATCCAAA
GCACGG