Detailed information on CNT30104316


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697878Oryza rufipogonOryza sativa10077.2198.21559forward
CNT30578598Oryza rufipogonOryza barthii97.1410098.34543forward
CNT30118094Oryza rufipogonOryza nivara89.98100100503forward

Expression of CNT30104316

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MSIRMPMNFSLSLSPINEDGSMHISLRMLNSCFLSARSTPARF*

>peptide 2 (29 aa)
YISAPDHHLLVFQTSRPCCCEETCPSGCR*

>peptide 3 (96 aa)
MSIKEPMNLSLSPSPIAEDVSMNILLRILMACFFSTESHWSHSRMLSKVPIALLLVDISCHRILFDFVGPYINRINRLSIFTPSSAIRDHSLCSFL*

Sequence

>CNT30104316
TCTACATATCTGCACCAGATCATCACCTGCTAGTTTTTCAAACAAGTCGCCCTTGCTGTTGTGAAGAAACATGTCCATCAGGATGCCGATGAATTTTTCT
CTGTCACTTTCGCCCATAAACGAAGATGGATCCATGCATATTTCTTTGAGAATGCTTAACTCTTGTTTCTTGAGCGCCAGATCTACACCTGCCAGATTTT
GAAAGTCACCATTACTGTTGTGAAGAGACATGTCCATCAAGGAGCCGATGAACCTTTCTCTGTCTCCTTCACCCATAGCTGAAGATGTATCCATGAATAT
CCTTCTGAGAATCCTTATGGCGTGTTTCTTCAGCACAGAGTCACATTGGTCACACTCAAGAATGCTCTCCAAGGTGCCGATTGCTTTGCTGCTTGTTGAT
ATTTCATGCCACAGAATATTGTTTGATTTTGTAGGGCCATACATAAATCGCATAAATCGGCTTAGTATCTTCACGCCGAGCTCTGCCATACGGGACCATT
CGTTATGTTCTTTTTTGTGAAGTGATCCCTTGGACGTTATAAGTGCCACAATCTTGTTG