Detailed information on CNT30104287


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697255Oryza rufipogonOryza sativa89.7874.33100501forward
CNT30110391Oryza rufipogonOryza longistaminata36.3853.9991.63203forward

Expression of CNT30104287

Peptides detected in this lncRNA

>peptide 1 (49 aa)
PSAASAVHPRPKVHTIITRICLDWGTRMQTWCREFFARLDMCVASTILV*

>peptide 2 (55 aa)
HQVQLAQFIPAQRCILLLQGYASIGGPGCRPGAESSLRDWICVLHPLYWCDLKLV*

>peptide 3 (69 aa)
MPRLGDPDADLVQRVLCEIGYVCCIHYIGVTSNWYDLLGGGLLVTWNAMFLILDKINSPNARSWRRGRF*

Sequence

>CNT30104287
CACCAAGTGCAGCTAGCGCAGTTCATCCCCGCCCAAAGGTGCATACTATTATTACAAGGATATGCCTCGATTGGGGGACCCGGATGCAGACCTGGTGCAG
AGAGTTCTTTGCGAGATTGGATATGTGTGTTGCATCCACTATATTGGTGTGACCTCAAACTGGTATGATTTATTAGGAGGCGGCCTTTTGGTGACATGGA
ATGCGATGTTTTTAATTCTAGACAAGATTAACTCGCCCAATGCACGGTCATGGCGTAGAGGAAGATTTTAGATACACGATGATGCATGCAACTCTTAATT
GCATGCTCAGTTCAAGTTGACATGTCATAATCTTAATATATGCATCATCATATTCTACTGTAGGATGATTCGAAGCTTGTGTATATACAAATGTACTATA
TATAAGACCTTGATATATTCATAACAAATCCTGGTTCAGTCATGTGTATATAATGAAGTTTCAACTCGATCGATTCAATCAATTAATACAGAGAATAATT
CTGGACTGGTTACCTTTGTAATTTTCAACATTTGTGCTAAGTGGCAATGATATAAGAG