Detailed information on CNT30104282


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT007260, E-value = 3e-32

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697076Oryza rufipogonOryza sativa36.410099.87756forward
CNT30555332Oryza rufipogonOryza glaberrima37.710098.47783forward
CNT30578243Oryza rufipogonOryza barthii39.5859.5798.54822forward
CNT30117969Oryza rufipogonOryza nivara37.4195.2297.3777forward

Expression of CNT30104282

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MYSSMLPLFHNSKFWTITRSSKYICLTMFF*

>peptide 2 (58 aa)
MVENELQSWYSSPLVTLVENAVIILEMVNCNLGLALGMYGRHRTSEFTNQDQSAVVVA*

>peptide 3 (75 aa)
FYDPHVSPTLLSLIRFSPPPSNTSMRRRPLFPVRAAPPFSPPHRVPFSGRQRASPAPPPEWIEAAPSPAATVGAD*

>peptide 4 (32 aa)
MAGNIIKYIITKFLLEKKPEKNCVSPHLVIFL*

>peptide 5 (34 aa)
MELMHALASTHPPPTASQLLSGCDSSKNNSWVPF*

Sequence

>CNT30104282
CTTCTATGACCCACATGTCAGCCCAACCCTTCTCTCACTGATTCGCTTCTCTCCTCCCCCATCGAACACATCGATGCGGCGCCGCCCTCTCTTCCCCGTC
CGAGCGGCGCCGCCCTTTTCCCCTCCCCACCGTGTCCCCTTCTCCGGCCGCCAGCGCGCGTCCCCGGCACCGCCGCCGGAGTGGATCGAGGCGGCTCCGT
CCCCGGCCGCCACCGTAGGTGCGGATTGAGGCGGCTCCCTCCCTGGACGCCATCGCAGGCGTAGATCGAGGCTGCTCCTTCCCCAGCCGCCGACGGCGGG
CGTCCATGGCCGCGTCGGGTCCTGATCTTCTATGGAGCTTATGCACGCGCTAGCATCGACGCATCCTCCCCCAACAGCCTCTCAACTCCTCTCCGGATGT
GATTCCAGCAAGAACAATTCCTGGGTGCCTTTTTGATTGACGAAGTGGATTCCGGTGAGAACTTCTGGCTTGCAGATTTGTGGCGTGCTGGCGAGAAGTT
TGAACGGCAAGAACCCGGTGAATTTGCTAATTTGTGGCGTGCTTGTTGATGATCACGGCGACGGTCACTGCAAGAAGTTTTTTTTTGGCTTGTTGAAGAT
TTCTGGTTTGCTTTGGTTAGCTTGTTGAAGTATTTATTGACATGACAAGTACTTATACGATTCGGAAACGGCAAGAGTTTGATTAGAGTTTAATTAGGAT
TGGTTTGTCTTTCAATGTTTCTAAAAGTGGTGTGAACATGCGGATTCCCAAAACATTGTCAGTTTCCAATGTATTGTATGACTCGGTTTTCCTATTTTCA
TTTTGACTGATTGTCCGATTCATCTTCTTTTCTCCTTTCTTTAGTTTTTAACTAATCCTAATCCTAATCTAGTTCTATTTTTCCTTTTTCTTATTTTTTT
GATTAATGTGAGAATTTCTAGGTTGTGAGAGCGAACATGGAGGCTTCTTTTTCTATTACTTTAAAGATATAATAGATTAGTGGACAGACAGAACCATAAA
TTTTGAATACTAGGAAGTACTTCATTTGACTGTGCTTCAATGGTGTCCTAGTACTAACAATTCCGAAAGATTAAGCGGAATGCTGAATTTCTTGCTCATA
TTCATATATGGTGGAGAATGAACTTCAAAGTTGGTATTCATCTCCATTAGTTACGTTAGTTGAGAATGCAGTTATCATTTTAGAAATGGTAAATTGCAAC
TTGGGTTTAGCCTTAGGCATGTATGGTAGACACAGAACATCAGAATTCACAAATCAGGATCAATCTGCTGTAGTGGTAGCCTGAAGTTATTTTGCAGATT
TGCTAATAAAATTGAGGGCATTCTAGCAACTTTTATCCAAAAGAAAAACATGATTAATAACACATTACCATGGCAGGAAATATAATTAAATACATAATTA
CGAAATTTTTATTAGAAAAAAAGCCAGAGAAAAACTGTGTTTCTCCACATTTAGTTATTTTTCTATAATGGATAGAAATCGGACCTCTATATTCTCCGCA
TTTAATCATTGACTGGATTATAAAAGTAATAACTCAGCACTAAAGAAGTAAAGATGATAGCAAACTATGTATAGTAGTATGCTCCCTCTGTTCCATAATT
CCAAGTTTTGGACAATAACACGATCTTCAAAATATATATGTTTGACTATGTTTTTTTAATAATAATATATATAATAAATTAACATATTTTTACTTTTATT
ATAATACTTTGTAAGATAAATCTATATATGTGTTGATTTAGGGTGTGTTTGCAAGAGCAAGTTCCCAACACTCTCCTCTCGTTTTCCGCGTGCACGCTTT
TCAAACTGCTAAATAGTGTGTTTTTTTTACAAAAAGTTTTTATACAAAAGTTATCAAAAAAATTCATATTGATCCATTTTTGAAAAAAAAATTAGTTAAT
ACTTAATTAATCACGTGTTAATGAACCGCTCCGTTTTTCATGTATAGGAGATGGTTTCTAACACCTATCTCCAAACATAGCCTTAAGTGCATTTAAACTA
AATAGTTTTAAAGTTATAAAAGTTTGATGACTTTAATATTATCCAAAACATTAAGAATCATGGAGCCGAAGGGGGAA