Detailed information on CNT30104278


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697206Oryza rufipogonOryza sativa47.3546.6100349forward
CNT30370565Oryza rufipogonOryza glumipatula24.6986.2691.76182forward
CNT30115456Oryza rufipogonOryza nivara44.3739.6888.38327forward

Expression of CNT30104278

Peptides detected in this lncRNA

>peptide 1 (33 aa)
LSSTMAATTGYCRSPSPEHCRPNPRATGLASMR*

>peptide 2 (32 aa)
LSLLPWQPPPAIADLPHRSIAGQTLAPPGLPR*

>peptide 3 (38 aa)
SLFYHGSHHRLLPISLTGALPAKPSRHRACLDEVNPFF*

>peptide 4 (73 aa)
MRVDGEHVMPPASPCFGHRRAGAPLVLSSPSLAANRRGEERRREEEEGEEKEKERLTESFWSLCRSREFNHIS*

Sequence

>CNT30104278
CTCTCTCTTCTACCATGGCAGCCACCACCGGCTATTGCCGATCTCCCTCACCGGAGCATTGCCGGCCAAACCCTCGCGCCACCGGGCTTGCCTCGATGAG
GTGAACCCATTTTTCTAGTGTCCATTCTCCCTTAGCCGTCCTATAAGCCACTATAGCCACTTCTTTTACCGGCCGGAGCAAGCTCTTGCCGCCGCCGTTC
CGGCTTCATCTCTCACTTCCACTGCTGACCTCTGCTGTACCCGGATGCGCGTCGACGGGGAACACGTTATGCCACCGGCGTCGCCGTGTTTTGGCCACCG
GAGGGCCGGCGCCCCGCTCGTCCTCTCTTCTCCCTCTCTCGCTGCCAACAGAAGAGGAGAAGAAAGAAGACGGGAGGAAGAAGAAGGAGAAGAAAAAGAA
AAAGAAAGACTGACAGAGTCATTTTGGAGTTTGTGCCGAAGCCGGGAGTTCAATCATATAAGTTAGTTTCATTTCAACCTAATTCTCAAGTCTAGATTAG
ATAGATGGTATAAGTCTATAGCCAAACATTAGAGTTAAGTCATTCTATAGCTTCTGCTGTATTAGTTAGCCACAAGTTTGTAAATACCCATATATTTTGT
AATAATATATCCTTTGGAGCCTTATTCAAATGTATGCAATGAAGATCCAGATTGTTGAACCTGTATCAATTTACTAATCTAGGGTTTGATACAGTCTAAA
CATGTCGGTTTCGGAATCATTAGTTTCGGGACCCGAC