Detailed information on CNT30104275


BLAST search results

BLAST vs Swiss-Prot:
sp|P0C5B3|MT1A_ORYSJ, E-value = 2e-18

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555477Oryza rufipogonOryza glaberrima79.5490.2599.49583forward
CNT30107782Oryza rufipogonOryza longistaminata53.4885.5994.64392forward
CNT30578098Oryza rufipogonOryza barthii79.81100.3499.15585forward
CNT30117926Oryza rufipogonOryza nivara69.1799.6199.41507forward

Expression of CNT30104275

Peptides detected in this lncRNA

>peptide 1 (62 aa)
MVDAGRHLNSCKGCTCSWNRSCSHGRSRRTLRPPQTAAPSSPAPHPARRWPWCCCSSLPGAV*

>peptide 2 (96 aa)
MQAGILTVARVAPAAGTAAAAMGGLAGLCGRLKLLRLLLRRHTQHDGGLGAAALLFQEQFEPQLQLDPQLQDIFSQSVIKLKQLKMKSTKEKKKSF*

>peptide 3 (38 aa)
MMSAMHSLRVLLASYRTGSRPAGKEAYITTALLRVPMI*

Sequence

>CNT30104275
GCCAAACCAGTTTAATATATTCATCACTTCATCTGTGGATACACCATTACAAGCATAGTACGTGAATAGTGAAACCAATAACATAGCACATCGATTAACC
CATCTCACACACACACACACCATATATATTGGTCAAGCACCAACCCAAATGGCCAAGCTTCTTTATTTTTCTGCATCACAATTCACACGCACACATGATA
GATGGTAGATGCAGGCAGGCATCTTAACAGTTGCAAGGGTTGCACCTGCAGCTGGAACCGCAGCTGCAGCCATGGGCGGTCTCGCCGGACTCTGCGGCCG
CCTCAAACTGCTGCGCCTTCTTCTCCGGCGCCACACCCAGCACGACGGTGGCCTTGGTGCTGCTGCTCTTCTCTTCCAGGAGCAGTTTGAGCCGCAGCTG
CAGCTAGATCCACAGCTGCAAGACATCTTCTCTCAGTCTGTAATTAAGCTCAAGCAACTGAAGATGAAATCAACTAAGGAGAAGAAGAAGAGCTTTTGAG
ATGATGAGCGCAATGCATAGCCTTCGGGTCCTCCTCGCTTCTTATAGGACTGGATCGAGGCCGGCCGGCAAAGAAGCGTATATTACCACGGCGTTGCTAC
GTGTCCCAATGATATAGGCTATTAGGCTGTCTGGAATTAGTCAATACAAGTTATCTCTCGTCCAATGGCCATTATTTGACAGTGAAGCTTTTTGTAGAGC
ATTTGATTTTGATTTTGATTTTGGTCTCTCACA