Detailed information on CNT30104243


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9XF89|CB5_ARATH, E-value = 2e-36

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697144Oryza rufipogonOryza sativa82.0454.5697.29443forward
CNT30677012Oryza rufipogonSetaria viridis32.5924.9688.64176forward
CNT30524410Oryza rufipogonSetaria italica32.5922.5188.64176forward
CNT30184672Oryza rufipogonSecale cereale25.7442.1293.53139forward
CNT30297056Oryza rufipogonTriticum aestivum31.675092.98171forward
CNT30390869Oryza rufipogonTriticum turgidum30.1934.6894.48163forward
CNT30555350Oryza rufipogonOryza glaberrima81.6777.3799.32441forward
CNT30438779Oryza rufipogonAegilops tauschii31.6727.192.98171forward
CNT30249379Oryza rufipogonAvena sativa39.2653.493.87212forward
CNT30664041Oryza rufipogonTriticum dicoccoides31.6745.695.91171forward
CNT30465769Oryza rufipogonSaccharum spontaneum32.0430.0987.86173forward
CNT30135675Oryza rufipogonLolium perenne31.6745.1290.64171forward
CNT30365046Oryza rufipogonSorghum bicolor32.0417.9688.44173forward
CNT30597100Oryza rufipogonOryza meridionalis84.8162.3197.6458forward
CNT30371256Oryza rufipogonOryza glumipatula100.5649.5999.45543forward
CNT30322408Oryza rufipogonAsparagus officinalis33.3320.7182.78180forward
CNT30151052Oryza rufipogonBrachypodium distachyon20.9348.7192.04113forward
CNT30578138Oryza rufipogonOryza barthii80.1951.61100433forward
CNT30117952Oryza rufipogonOryza nivara99.0743.0499.44535forward

Expression of CNT30104243

Peptides detected in this lncRNA

>peptide 1 (57 aa)
MKNPSMENMASRPFLISFTFSSAAWSGSLASPSGSNGPPGWSLSSRSCTTIAIAGESP

>peptide 2 (60 aa)
KIQGNHSAMSTMMKTTSRQFTQVANISQPQIQTLGPSYQKIRMNRFSNSSPNSTIIYTYI*

>peptide 3 (82 aa)
KNPGKPFSNVNDDENHFETIYSGSKYFSATNPNTWSFLSEDQNEQVFKFISQLDDNLHVHLTHSSTLLKLLPSSSRVRLKLT*

Sequence

>CNT30104243
AAAAAATCCAGGGAAACCATTCAGCAATGTCAACGATGATGAAAACCACTTCGAGACAATTTACTCAGGTAGCAAATATTTCTCAGCCACAAATCCAAAC
ACTTGGTCCTTCCTATCAGAAGATCAGAATGAACAGGTTTTCAAATTCATCTCCCAACTCGACGATAATTTACACGTACATTTAACACATTCTTCCACCC
TTCTCAAACTCCTCCCTTCTTCTTCCCGGGTAAGATTAAAATTAACTTGAGGCCAGCCAGCGTCGCCGGCGGCGAGATGTTTACAGGCTGGGCGTCCTCT
CGGCGGCGCCGGAGATGACGGTGAGCAGGTTCTCGACGGGGCCCTCGCCGGTGACGTAGGCCTGGATGAAGAACCCCAGCATGGAGAACATGGCCAGCCG
CCCGTTCTTGATCTCCTTCACCTTCAGCAGCGCCGCCTGGTCCGGGTCGCTCGCCAGCCCCAGCGGGTCGAATGGGCCACCTGGGTGGAGCTTGTCCTCC
AGATCCTGCACCACCATCGCCATCGCCGGCGAATCTCCGG