Detailed information on CNT30104226


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0IQF7|RS16_ORYSJ, E-value = 2e-73

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696918Oryza rufipogonOryza sativa68.8365.9399.7329forward
CNT30515426Oryza rufipogonJuglans regia23.648.686.73113forward
CNT3043803Oryza rufipogonPrunus dulcis27.8225.3881.95133forward
CNT30295032Oryza rufipogonTriticum aestivum44.9841.1986.98215forward
CNT30391876Oryza rufipogonTriticum turgidum46.8610087.95224forward
CNT30568235Oryza rufipogonActinidia chinensis49.3778.9380.08236forward
CNT3083687Oryza rufipogonVigna radiata20.0810.0985.4296forward
CNT30555324Oryza rufipogonOryza glaberrima68.8389.6599.7329forward
CNT30438780Oryza rufipogonAegilops tauschii68.8340.9787.84329forward
CNT30247768Oryza rufipogonAvena sativa51.2640.389.8245forward
CNT30663140Oryza rufipogonTriticum dicoccoides53.7737.2588.33257forward
CNT30472632Oryza rufipogonSaccharum spontaneum68.836.7391.49329forward
CNT30136796Oryza rufipogonLolium perenne23.6416.5490.27113forward
CNT30232050Oryza rufipogonAnanas comosus53.7722.5683.27257forward
CNT30721366Oryza rufipogonTriticum spelta55.0251.1786.31263forward
CNT30365247Oryza rufipogonSorghum bicolor54.638.4490.42261forward
CNT30620437Oryza rufipogonCajanus cajan29.2919.6483.57140forward
CNT30120766Oryza rufipogonCitrus clementina26.7823.6681.25128forward
CNT30151249Oryza rufipogonBrachypodium distachyon67.9962.3890.15325forward
CNT30117820Oryza rufipogonOryza nivara68.8342.18100329forward
CNT30176592Oryza rufipogonVigna angularis20.0811.7887.596forward

Expression of CNT30104226

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MSMSLKRDLPASRMGSNALRRSISGLISSIGTPFTLISPRPGLQ*

>peptide 2 (55 aa)
VIAGKDVLDLLLGRLVDVLLVVGDEGLGDGLADRVDLRRLPSAADADPHVDVLEA*

>peptide 3 (32 aa)
MVAAVVARGGGGGGGGGGGSISLLPLGWSSHG*

Sequence

>CNT30104226
CGGTCATAGCGGGCAAAGATGTCCTTGACCTCCTTCTTGGACGCCTCGTCGACGTACTTCTGGTAGTAGGCGACGAGGGCCTTGGCGATGGCCTGGCGGA
TCGCGTAGATCTGCGACGTCTTCCCTCCGCCGCGGACGCGGATCCTCATGTCGATGTCCTTGAAGCGTGACCTCCCCGCGAGCAGGATGGGCTCGAACGC
CTTGAGGCGGAGCATCTCCGGCCTGATCAGCTCGATCGGGACGCCGTTCACCTTGATCAGCCCGCGCCCCGGCTTGCAGTAGGAGACGGCCACCGCCGTC
TTCTTGCGCCCGAAGCACTGGACCGTGCCTGGCGGCGGGCGGGTGAGCGCGGCGGCCATGGTTGCGGCGGTGGTGGCGCGCGGCGGCGGCGGCGGAGGCG
GAGGCGGAGGCGGATCGATCTCCCTACTCCCCCTAGGCTGGAGTAGCCATGGATGAGAAGGAAAGGAAGGGAAGGAAG