Detailed information on CNT30104198


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001506, E-value = 3e-174

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30104198

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MQCLKPCSFPVVFSFVVCFSVPIVNLVSSSASCHLLKG

>peptide 2 (60 aa)
EKGTGRRRTRRPSGEAAVAVGGGSAARGGGAGAKAKRRGGAAALGGQRWRRCCKSSITSF*

>peptide 3 (67 aa)
RKGDRAAEDSTALGRGGGGGGRRLSGAWRRRWCEGEAARWCGGARRPAVAAMLQVIDYKFLNRVWSC*

>peptide 4 (33 aa)
MMCCQWRLIDSRRRPLNFCLVFLEDTRDVFIVM*

>peptide 5 (43 aa)
KRGPGGGGLDGPRERRRWRWAAAQRRVAAALVRRRSGEVVRRR*

Sequence

>CNT30104198
AGAAAAGGGGACCGGGCGGCGGAGGACTCGACGGCCCTCGGGAGAGGCGGCGGTGGCGGTGGGCGGCGGCTCAGCGGCGCGTGGCGGCGGCGCTGGTGCG
AAGGCGAAGCGGCGAGGTGGTGCGGCGGCGCTAGGCGGCCAGCGGTGGCGGCGATGTTGCAAGTCATCGATTACAAGTTTCTGAATCGGGTGTGGTCTTG
TTGAAGCCCCATGATGTGTTGCCAATGGAGATTAATTGATTCTAGAAGAAGACCTTTGAACTTTTGTCTTGTTTTTCTTGAAGATACTAGAGATGTTTTT
ATTGTGATGTAGCTAGAAAATTAGAATCTTAACATTTTCCCTGAAATGCAGTGTCTCAAACCTTGTAGTTTCCCAGTAGTTTTTAGTTTTGTAGTTTGTT
TTTCGGTTCCTATTGTAAACCTTGTAAGTTCTTCGGCTTCTTGCCATCTTTTGAAAGGAAT