Detailed information on CNT30104186


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694478Oryza rufipogonOryza sativa49.6341.8495.5200forward
CNT30555520Oryza rufipogonOryza glaberrima51.8643.9195.69209forward
CNT30369512Oryza rufipogonOryza glumipatula51.8642.3993.78209forward
CNT30110773Oryza rufipogonOryza longistaminata30.5217.495.93123forward
CNT30117765Oryza rufipogonOryza nivara30.7749.892.74124forward

Expression of CNT30104186

Peptides detected in this lncRNA

>peptide 1 (61 aa)
PAVPSTSQNPRRSPPPPPSRHLVPWGRPPPPLVDLPHACPTADLGRREEEERERRKRRELR*

>peptide 2 (50 aa)
MQLEFISSSVKVLAVTCLHEGMGLATQSHDMISLSHDYCNILIRILVFRHN

>peptide 3 (31 aa)
QLSPPHPKTLGGPPHLPLAVIWYPGGAHLPL*

Sequence

>CNT30104186
CCCAGCTGTCCCCTCCACATCCCAAAACCCTAGGAGGTCCCCCCCACCTCCCCCTAGCCGTCATTTGGTACCCTGGGGGCGCCCACCTCCCCCTCTAGTC
GACCTCCCCCATGCCTGCCCTACTGCAGACCTGGGAAGAAGGGAAGAAGAAGAAAGGGAAAGAAGGAAGCGGAGGGAATTGAGGTGAAGAAGGAAATGAG
GGGTTTTGGTTGCCGCTGCCCATGGAGGCCTAGGTGATGCCACTTCGGAATGCAACTAGAGTTCATCTCATCATCGGTGAAGGTACTTGCTGTGACATGT
TTGCATGAAGGGATGGGATTAGCTACACAGTCGCACGACATGATCTCACTTAGTCATGATTATTGTAATATCTTGATAAGAATACTTGTGTTTAGACATA
ATG