Detailed information on CNT30104170


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004427, E-value = 2e-90

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697190Oryza rufipogonOryza sativa30.2974.2786.451166reverse complement
CNT30371302Oryza rufipogonOryza glumipatula15.9554.9797.56614reverse complement
CNT30578262Oryza rufipogonOryza barthii12.1821.2890.83469forward
CNT30603845Oryza rufipogonOryza punctata9.8296.6882.54378forward

Expression of CNT30104170

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MGSCMLIPSALSISMHAIALFACFCSSLLALLSLD*

>peptide 2 (80 aa)
MALSCIGHCLHHSLHPCLLWGSCSSTLLMGFQISYQHVDDGVFLMICLWLNSTFLKTETVWCTSSATGAASHLNSQKRAR*

>peptide 3 (94 aa)
MQLDEVQAILWCGAVLNEELTQVPITKHPQDYVVDGILHANPISLEHLHACYSALRLLLLLPPGPTFIGLNPQVSQPIKCISGGVPPSPLAVAT*

>peptide 4 (39 aa)
MLRIELERYIPKHTTPLLTCSKAITIWIQYEGMKYKQGS*

>peptide 5 (50 aa)
MHHEQNMAPERHKQAEAVLKHCCTVSTTISTIATIIVIWTEPLVPALNMA*

>peptide 6 (38 aa)
MRVSIGCDSRYGQGYLVSVRPEGGCGRCQKAEPTRWWQ*

>peptide 7 (94 aa)
MPEGRTHEVVAVVVGQAAECSPGEVLVHKLKGRTGHIEVVRAKAQPVCTTTRVKVHRQLATGRVAVHGVPKVLRTGEAKETTRKQARSLSWSTW*

>peptide 8 (50 aa)
MREFCLASSVTHYGTELHWPLSPSFTASLPVVGVLQLYLAHGLPNQLPTC*

>peptide 9 (30 aa)
MKYRRSSGVVQSSMKNSRRYPSRNILRTMW*

>peptide 10 (37 aa)
MLDMNRSKLLNRHHREIKRCITNRTWHQSDISKQKQC*

>peptide 11 (36 aa)
MVPKLFKKPLNLNKAYNKHDARYESEQVIKQTSQGN*

>peptide 12 (31 aa)
MILLPLLRGTKDGSREGGRSARLVRSSTSRI*

Sequence

>CNT30104170
TAAAGGCAATCAACGAAAGGCAAATAAATATCAGCTCAACATAATTTATTCAAGCACTGCAGCTCATAGTTCAAATTAATGGTGCCGAAATTGTTCAAGA
AGCCACTCAACTTAAATAAGGCCTACAACAAGCACGATGCTCGATATGAATCGGAGCAAGTTATTAAACAGACATCACAGGGAAATTAAAAGATGCATCA
CGAACAGAACATGGCACCAGAGCGACATAAGCAAGCAGAAGCAGTGCTAAAACACTGCTGCACCGTCAGCACCACCATTAGCACCATCGCTACCATCATC
GTCATCTGGACCGAACCTCTTGTACCAGCCCTCAACATGGCCTGAGCAGGTTGGTGGTGGCGGTGGAGCAAACAACAGGGGGTCAGGAGTGAGGTCTGGT
GCACCATGCAGCTGGATGAAGTACAGGCGATCCTCTGGTGTGGTGCAGTCCTCAATGAAGAACTCACGCAGGTACCCATCACGAAACATCCTCAGGACTA
TGTGGTAGATGGGATCCTGCATGCTAATCCCATCAGCCTTGAGCATCTCCATGCATGCTATAGCGCTCTTCGCTTGCTTCTGCTCCTCCCTCCTGGCCCT
ACTTTCATTGGACTGAACCCTCAGGTCAGCCAGCCTATTAAATGCATCTCCGGTGGAGTCCCTCCTAGTCCCCTTGCTGTTGCCACCTGAAGAGTAGCCG
GGAGTCATGATTCTCTTGCCCCTTCTGCGCGGAACTAAGGATGGCTCCAGAGAAGGTGGTAGGAGTGCCAGGCTGGTGAGATCATCAACATCTAGGATCT
GAGCCTTTTGGAGGACCTGTGGTGGTGCCGGCCTGTGTCCAGCAACGCTAGACTTGTTGAGCGTAACTATCCTACCACTATACACTGCGTGATGCTCAGG
ATTGAACTTGAGAGGTACATTCCTAAACACACGACACCTCTCCTCACCTGCAGCAAAGCCATAACAATTTGGATTCAATATGAAGGTATGAAATACAAAC
AGGGCAGCTAATAATGTGAGAAGTACATGCAGTTCAGATAGACAGTGCACACAGAACCAAAAAAACATTAAATCACAGTTCAGCTGTGCAGTTCAATCAA
GTCAAAATATGCGTTTTCTGTCATAATTGGTTGTGCCCTACACATAACAGGTTTCAGTTTGGTGCAAAAGGAGCATAAACTTCAGTTAGATGTATGTATT
ATGTTTAGTTGTGCAAGGTATGCAGCTAGATGTTTTCAATTCAGCTAGATGTTTTCTATTCAGATAGATAGTGCATTGAGACATGGTACTAATAGTAAGC
TGTAAGATGATTTCGTTAGAAAAAAAGACATTAGCATTTGTAAATTTCAGCAGAACCATATGAACTCACATATGCCTGTCAAATCAGGTAAGTCCATCAA
TCATATATACAAATAGTTTCACAGATGTATCAACTTCCTATAGTACAGTCATGTTAAGTTCATCTAGCATGCATATAGAGATGTATGTAGCTCTTCCTAA
ATTAATCTAAATATCAGGAAAAACATTTGTACTCAGATGTATCTCTAGATTCAGTTGTCATTCATTCATCTAGCATGTATATTTACAAGTAAGTAGGTTC
TGTAACCTAAATGTTGTAAGTTAACCTATATATGAGGCAAACCAGATGTACTCAGAAAATGTCCAAAATCAGTTTAGTCAATCCTTCGTCTCTACACCTA
TAACCATGTAAATCACACATGTTGAACCTTGCATATTCATATATATATTCAGATTAATTTAAGTACAACCATCTAAGTTTAGCGGTCAGATATGCATAGT
AGTTTTAATTAGCTATCCTGAATTCAAACAAAGGTGTTTAGCTCACTTCTAATATAGTAAGTTGGCATCATTTTGACAACCTGCAGTGCATCTATACCCA
ACAACATTTCTGTATGTTAACTGTATGTAATTATCATGGATGTGTCAATACAAGGTGCACTTAGCATAAAACATCTGAGTACGACTTTCTAGCAATTTGA
GTGCACACATGGACATGCAGAAACTTACCAGGATGCTCAGAATTTATTATCTGTGTTGGCAGTACAGCTGACCAAACATTTCGACAGGCAGTTGGCAAAT
TACAGCAGTCATATTGTAATAAAATGGAAACTATGCTGCATGTAGATGATTAAGTAATGTACAGCTGCATAGTTTGACATATCTACATATGGTCTGAACT
AACTTAAGCATCTGTACAGACAGCAGTGCTGTAAATCTCATATCTTAATGCATGTAGAGTCATATATATCACTTGAAATCAGAGCAACTGGCACTACTAC
TATGTTATATGTCATGTGATAAATCTAAAGGCCTATGTTGCACATAGCTAATATCCCAAACAATGCGTGAATTTTGTCTGGCCTCATCCGTAACACATTA
TGGCACTGAGCTGCATTGGCCATTGTCTCCATCATTCACTGCATCCCTGCCTGTTGTGGGGGTCTTGCAGCTCTACCTTGCTCATGGGCTTCCAAATCAG
CTACCAACATGTTGATGATGGAGTCTTCCTCATGATCTGCCTCTGGCTCAACTCTACCTTCCTCAAAACCGAAACGGTTTGGTGCACGAGCAGTGCGACG
GGGGCGGCTAGCCATCTAAACTCCCAGAAAAGGGCAAGGTAAGAATCAGATAAGCACTTAAAGAAGACAAGAAGCAAAGTAAATAACAACTCAGATAGCA
TACACTAGGCATAAACTGGATTTCTCAAATCATAAAGACACCTGATACAACGGGTGTGGACATGTCACAGATCTACGTCGAGCTTGACTGTACGCACACC
ACCTAGGAGATCCAGACTACCATACAACACCCATATCAAACACACACACGCACTACTTCGCCACGACTCCAAAAGAGTTGGTGGCGGAACAAAAGGGCCT
AACACCCGAACAACTGCTAAAGACTGCCTCCTCTACTCCTCGCCTGCCTGCCTGGCTCCAGTGGTCGACTCCTCAGTCGAAGAGACGTAGATCGGCGCAC
TCGAAGAGACCAGTGGAACCTGTCGAGGGCCGGCAGCAGCACGGGCAGCTGGCGGAGGGGAGCTAGGTAGTCAAAGCGGAACACAGTGGAGGAACCAACA
ACATGCTTCCGTGCAGTGCGGATAAAGCGTGGGCCACGGCGAGAGGAAGCAACTGGGTGTGACCGGCGGGGTAAGAGGGGCTAGCTGGGTGTGGGTAGGG
GGAGTACACTGGCGAGTACAGCACACGCAAGCTGGGGGAGCGCGGGCCACTGGGAGTGCGAGCAGAGCCAAGGGAGCTGTAGAAGGACAAGTGGCTAGAG
TGGCAGAGGCGGCCTGAGTCCCAAGAGGCAGTGCCAACGGAGGTGACACCCTCCTCGCCCAGGCGGGCCTCCAGAGCAGCGTAGCGGCGAGCAAGGGAGC
GGTAAGCCTCAAGGAGAAGGTCGTGTTGGGTAGCCTAGGCGTCAGAAAGCTCCACCATGCGGGTCAGCATAGGGTGCGACTCACGGTACGGGCAAGGGTA
CCTGGTGTCAGTGCGGCCTGAAGGAGGCTGTGGGAGATGCCAGAAGGCCGAACCCACGAGGTGGTGGCAGTAGTCGTAGGCCAAGCGGCGGAGTGCAGTC
CAGGAGAGGTCCTAGTACACAAGCTGAAGGGTAGGACGGGCCACATTGAAGTGGTGAGGGCGAAGGCCCAGCCCGTGTGCACCACTACGAGGGTAAAGGT
ACACAGACAACTCGCAACGGGGAGGGTAGCGGTACACGGAGTACCCAAAGTACTCAGGACGGGAGAAGCCAAGGAAACAACAAGGAAACAAGCAAGGTCT
CTCAGCTGGTCGACATGGTGACCCTCACCAACACCATGGGAACTGTGGA