Detailed information on CNT30104132


BLAST search results

BLAST vs Swiss-Prot:
sp|B9G9L9|BURPH_ORYSJ, E-value = 6e-118

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697316Oryza rufipogonOryza sativa91.6399.8499.04624forward

Expression of CNT30104132

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MELGIGVLGRMDRQYCSGDRSAAWLTAAIYTHKTSKLC

>peptide 2 (57 aa)
MTCNCVDHLYSELVQWQVKLITCNCVDHHLHGEVVQQQVKLITCSCVDHHLHGEVVH*

>peptide 3 (33 aa)
VEGVINFFTLLKILLKEEERHVGVFEKFWRLQN*

Sequence

>CNT30104132
AAGTGGAGGGCGTTATTAATTTTTTTACCTTGTTGAAGATTCTTCTCAAGGAAGAAGAGCGCCATGTCGGGGTCTTTGAGAAGTTCTGGCGTCTCCAAAA
CTGATGACTTGTAATTGCGTTGACCATCTGTATAGTGAACTAGTTCAGTGGCAGGTAAAACTGATAACTTGTAATTGCGTTGACCATCATCTACACGGTG
AGGTAGTTCAGCAGCAGGTGAAACTGATAACTTGTAGTTGCGTTGACCATCATCTGCACGGTGAGGTAGTTCATTAGTGGCAGGTAAAGCTGATAACTTG
TAGTTGCGTTGACCATCATCTACACGGTGAGATAGTTCAGCCATAGGTGAAACTGATGACTTGTAGTTGCGTTGACCAGCATCCGTACGGTGAGGTAGTT
CATTAGTGGCAGGTAAAGCTGATAACTTGTAGTTGCGTTGGCCATCATCTACACGGTGAGATCGTTCAGCCACATGTGAAACTGATGATTTGTAGTTGCG
CTGACCAGCATCCGTACGGCGAGGTAATCTAACAGCAGGCAAGTAAGGGTAGTTAAGAAGTTGGGAGATGGAGCTTGGCATTGGGGTGTTAGGGAGGATG
GATCGCCAGTATTGCTCGGGGGACAGATCAGCTGCATGGCTTACTGCCGCAATCTACACACATAAAACTTCAAAATTATGC