Detailed information on CNT30104116


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000044, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694361Oryza rufipogonOryza sativa50.1839.5392.291388forward
CNT30576723Oryza rufipogonOryza barthii49.8933.2891.521380forward
CNT30115711Oryza rufipogonOryza nivara49.7558.690.921376forward

Expression of CNT30104116

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MWYLCTVVPFVSPRAGGNLMLSRASYDIYQGAGKYTDFRS*

>peptide 2 (45 aa)
MVVREALLAGCGWTDEKEEEKRKERKNKKKKKRRWQPCRILEESS*

>peptide 3 (29 aa)
MEIYLITKTSLRNKKHFTVYFFLFFLSSC*

>peptide 4 (30 aa)
MNLIHSIYFKTRIFKYCIGFFIISCGLYQP*

>peptide 5 (38 aa)
HPSELSLSLSSLSTMTGHHHCHRPISSSTALHPKTLRH*

>peptide 6 (76 aa)
MSLWAKSIAKNTNIQINRRGKAANQLAHHFVKLARRHLGVSQVNSCNFSLKWLKENLNSTVNFSRAHAVWPVSCIW*

>peptide 7 (29 aa)
MCQSRLGWWERGEGDGGTGGIVGGMRMDG*

>peptide 8 (48 aa)
MGTRVHGTGATIVSNLILGMTKLMNIGKSWTAGKAYIYCSRVFMKLFE*

>peptide 9 (56 aa)
MRVAREHIFPPTSQPLDHRSTGAPPLPLLCVRLEEEAEGERIREEEEEKKKRKESP*

>peptide 10 (43 aa)
PSIRVISLSFFSLHHDRPPPLPPADLLFHSPTSQNLAPLARPR*

>peptide 11 (37 aa)
MIGRMCETNQCKFKQQRRGGRIRPCIDGTKTFKSLSHR

>peptide 12 (33 aa)
MGTDLVIRLINNVVPLYSGSFCKSSRRRQSYAE*

>peptide 13 (39 aa)
MRRKKKRERKGKTRRKRKGGGSHVGFWRSRHNFGSKRYT*

>peptide 14 (71 aa)
MSKRMQRRSRLSKLYQPTDPGLDTVKHVGFRIISFGTRQMGRKVTANGKWEAGDEDIRVMDYGERGDMLCL*

Sequence

>CNT30104116
TCCATCCATCCGAGTTATCTCTCTCTCTTTCTTCTCTCTCCACCATGACCGGCCACCACCATTGCCACCGGCCGATCTCCTCTTCCACAGCCCTACATCC
CAAAACCTTGCGCCATTAGCTCGGCCTCGATGAGGTGATTCCATTTTTTCCCCTTTCCCCTCTCCCTCTACCTTGAGATAAACCGCCACCGCCACCTCCC
AAATTGGCCGAGCCAAGCTCTTGCCGTCGCCGTTCCGGCCTCCTCGCTTGTTTCCTTCGCTGGCCGACTGGTTCCCTGGATGCGCGTCGCTCGGGAACAT
ATTTTTCCGCCGACGTCGCAGCCTCTCGACCACCGGAGCACCGGCGCCCCTCCTCTCCCTCTCCTCTGTGTTCGGCTGGAAGAAGAAGCAGAAGGAGAGA
GGATACGGGAGGAAGAAGAAGAGAAAAAGAAAAGAAAAGAATCTCCCTGACAGAGTCTATTTTATTCTGGATGGCAACCTGTGGTATTTCGAGCATCGGA
TAATCAGGTTGCCTATCTCGGATTTATTTGCGTTGGAGCAAGGCAAGTTATTATTCCTTCCCTTTGAGCATAAATGTCCTATATTCTATATTCTATTCTA
TGCACTAGCCATACATGATTTTGAATGCATAATCTGAACATATATAGCGAACCAGTTATATGCTAGCTTTTGCTTAGCCATGCTTAGTTAGAATATGCAT
AAAATTCAATGAACTTAGATTGGGACAGTACGTAAGATTTGGTTGATTTCCGGGTGGCTAGTATTGTCTCAGTCGATATAAGTTTATACCAAATACTTAT
GTCAAACGAACGAGTACGACCGCAGCTTCTAGAATGGGGACAGACCTAGTTATTAGGTTAATTAACAATGTGGTACCTCTGTACAGTGGTTCCTTTTGTA
AGTCCTCGCGCAGGAGGCAATCTTATGCTGAGTAGGGCATCTTATGATATTTACCAAGGCGCAGGTAAATATACTGATTTTCGCTCATGAGCTGTGTGTG
TGATTTTATGGAAACCTGGTTGAGATGACGTGGGGTCTCTCATCCAGTTCTCTCTAAAAACCCCGGGAACGCCAGAACTCCTCTCGCTGCTGATAACGTT
ACGTTCAGAGCGCATGGGGACTAGAGTTCATGGAACAGGTGCCACTATTGTTAGTAACCTAATACTGGGCATGACTAAGCTAATGAATATTGGCAAGTCG
TGGACTGCGGGTAAAGCGTACATTTACTGCAGTAGAGTATTCATGAAACTATTCGAATAGCCGTGCTCACGGAATTGAGTATCGGGACTCATATGGTATT
TGGTTAGAAACTTAACTCAAGATTTTACTAAATACTGTTGCATAAAGACATACCAGGCTTTCTTCATCTTTATTCTTAGCTTTCTGCCAGTAAACCTAGA
TCTACTTAAATACTATTTCATGCATTCATTATTTGATATAATAGCTTGCTGAGTACATTGTACTCACCCTTGCTTCAACCACCTTTTTCAGAGTCCATTT
GATGTTCTTGCCGAAGTCAGGAGTTCAATCACATAAGTTAGTTCTCTTTTAACTTAATCTTCAAGTCTAGGTAATTTAAATGGGTTTAAGTCTATAGTAA
AGTAAAACAACAGAGTTAGGTCATTCTAAAGCTTCTGCTGTAATAGTTAGCCACAATCTCGTAAATACCCTATTACTTTATGTAATATTATCTCCTTCAA
AGCTATGTCTAAACGTATGCAAAGACGATCCAGATTGTCGAAGCTGTATCAACCTACTGATCCAGGGCTTGATACAGTTAAACATGTCGGTTTCCGAATC
ATTAGTTTTGGGACCCGACAGATGGGGAGAAAGGTGACCGCCAACGGGAAGTGGGAGGCAGGCGATGAGGATATAAGGGTGATGGACTACGGGGAGAGGG
GCGACATGCTTTGTCTATAGGATGGCGCCGCCCAAGGTCAGGTAGGCTAGGAATGTGTCAAAGTCGTCTTGGCTGGTGGGAGAGAGGTGAAGGTGATGGT
GGTACGGGAGGCATTGTTGGCGGGATGCGGATGGACGGATGAGAAGGAAGAAGAAAAGAGAAAGGAAAGGAAAAACAAGAAGAAAAAGAAAAGGAGGTGG
CAGCCATGTAGGATTTTGGAGGAGTCGTCATAATTTTGGATCAAAAAGATACACTTGATAAAATTACCAGAATCAACATTTAGAGTGTATGGAGATCTAC
TTGATAACAAAAACAAGTTTAAGAAACAAAAAGCACTTCACTGTTTATTTTTTCCTTTTCTTTCTGTCATCGTGCTAAATGAATCTTATACACTCTATCT
ACTTCAAAACGAGGATATTTAAATACTGCATCGGATTTTTCATAATTTCTTGCGGCCTCTACCAGCCTTGATCGGTCGCATTCATGTACTATTCATTGTT
TTGAATGTCCCTCTGGGCAAAGTCAATAGCAAAAAACACGAATATTCAAATAAATAGAAGAGGTAAGGCTGCGAACCAGCTAGCCCATCATTTTGTGAAG
CTAGCCAGAAGACACTTGGGCGTTTCTCAAGTCAATAGCTGTAATTTTTCACTAAAATGGTTGAAAGAAAACCTCAATTCAACAGTCAATTTTTCCCGCG
CACACGCCGTATGGCCCGTATCGTGCATATGGTGATAGAATGACGATGACATGATTGGCCGTATGTGCGAGACTAATCAGTGCAAATTTAAGCAGCAAAG
GCGAGGTGGCCGTATAAGGCCCTGTATAGATGGGACTAAAACTTTTAAGTCCCTATCACATCGGAT