Detailed information on CNT30104088


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003140, E-value = 2e-99

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30524183Oryza rufipogonSetaria italica2.8430.2984.3483forward
CNT30555398Oryza rufipogonOryza glaberrima20.3965.4298.66596forward
CNT30474992Oryza rufipogonSaccharum spontaneum2.9821.1787.3687reverse complement
CNT30597153Oryza rufipogonOryza meridionalis8.6231.1194.44252reverse complement
CNT30369884Oryza rufipogonOryza glumipatula10.8527.7189.27317forward
CNT30109079Oryza rufipogonOryza longistaminata6.9424.9793.1203forward
CNT30578078Oryza rufipogonOryza barthii30.8937.3899903forward
CNT30551326Oryza rufipogonOryza brachyantha6.1945.1485.08181forward

Expression of CNT30104088

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MLKFRTNCPIFSSKETSLKILQCRQSIVFNVILQATA*

>peptide 2 (33 aa)
MFPVIILYFSYSSVFSFLSESYIFPIPGLSFPM*

>peptide 3 (37 aa)
MCDSNGPLKFDPFFHSCQNLIFFLFLYFFIPVIQMGP*

>peptide 4 (51 aa)
MFGSIIVLGVLINGRRHEVDIFFHGFMFVLFGFEEMKRLQGANSLETSRIF*

>peptide 5 (53 aa)
MANRAYELFRKHSAKPQPHPLMLFSPISHSVGPSRSGRLTHRPPLPPHPSKLT*

>peptide 6 (52 aa)
MPRFGLQKRPAMYMNRYKPVEPAGFLLNRLKTGAVGPRTMLAAGKNINLGPL*

>peptide 7 (65 aa)
MSSPGQSPVRFFPLWLTGPMNYLENTVQNRSHILLCSSPPYLTRSVLLVLVVSLIALPFPLIHRS*

>peptide 8 (49 aa)
MAQSNNHSYVSCHNLIFFLFLRFFIPVRILYFSYSWTVFSYVSFGGPIK*

>peptide 9 (29 aa)
MWVTVALMVNHGLIRLKRFVSRFTCKLCN*

Sequence

>CNT30104088
GTAAATGTTATCAATCAAAACTAGGGTCTTTGTTGTGAATATCTGAATCTTGAATTAACAATCATAGGGGTACTTTTGAGAATAAGGGCCTGTTTAGTTG
GTGAAATAAAAATTTTAGGTGTCACGTAAGACGTTTGACCGGATATCGGAAGGGGTTTTCGGACACGAATGAAAAAACTAATTTTATAACTTGTCTGGAA
ACCGCGAGACAAATCTTTTGAGCCTAATTAAGCCGTCATTAGTACATGTGGGTTACTGTAGCACTTATGGTTAATCATGGACTAATTAGGCTCAAAAGAT
TCGTCTCGCGATTTACATGCAAACTGTGTAATTAGTTTTCATATTTATCTATATTTAATACTTTGTACATGTGTCTAAAGATTCGATGTGATGTTTTTAA
AAAAAGTTTTTAGAAACTAAGGTCCCTCCTTCCCAAACACCACCTAACAGCCTAGTAAAAAAAACGGACCGGTCCGGCAGTTCAACCGGAAAAAACCGGA
ACCAGTGCATGCCACGGTTCGGTTTGCAGAAAAGACCAGCAATGTATATGAACCGGTATAAACCCGTCGAACCAGCCGGTTTTCTGTTAAACCGGCTTAA
AACCGGAGCGGTTGGACCGAGAACCATGCTAGCTGCAGGGAAAAATATAAATTTAGGGCCCCTATGATTCAAAGGAAATTTATAGGAATTTTAGAGGATT
TTATTCCTATAGGATTTTTTCCTATATAGCCTTTTGAATCAAAGGAATGGATCCTATGGAATCCTATGGCCCAATCAAATAATCATTCATATGTTTCCTG
TCATAATCTTATATTTTTCCTATTCCTCCGTTTTTTCATTCCTGTCAGAATCTTATATTTTTCCTATTCCTGGACTGTCTTTTCCTATGTAAGTTTTGGC
GGCCCAATCAAATAATCATTCATATGTCTTTTCCTATGTAAGTTTTGGCGGCCCAATCAAATAATCATTCATCATTCATATGTGTGATTCAAATGGGCCC
TTAAAGTTTGATCCGTTTTTTCATTCCTGTCAGAATCTTATATTTTTCCTATTCCTCTATTTTTTCATTCCTGTGATTCAAATGGGCCCTTAAAGTTTGA
GCAAAAGGGGAGTTGAACCCTAGACCACATGCTTGAAGCGCTACACGCTTTGTACTTTCCAACCTAACCAACTGGGCAAGAGATATGTGCTGTTCAGAAT
GGAATACCTATTCTATTTAGCAGTTTAAAGTCAATTATGACTTAAAATATAGTTAGCCATGAACCGGCGGTCCGGTGAACCAGCGAACCGATGAGCTCAC
CGGGTCAGTCTCCGGTCCGGTTTTTTCCACTATGGCTAACAGGGCCTATGAATTATTTAGAAAACACAGTGCAAAACCGCAGCCACATCCTCTTATGCTC
TTCTCCCCCATATCTCACTCGGTCGGTCCTTCTCGTTCTGGTCGTCTCACTCATCGCCCTCCCCTTCCCCCTCATCCATCGAAGCTAACTTGAGAGAGAG
AGAGAGAGAGAGGGAAAGCTTGCCGTCCACCATCCAAATCCGGAGGTGGCCCTGAGCCATCCAGATCCAGCGGGAGGCGGTGAAGGTGGCAGGGGCACGG
GTAGATGATGCAAGATTGAAAACAGCAAAGGTGCGCACAACTGAGCATTTTGTCCGGCGTTGTTGCAATGCATCCAACTCCAACATGAGAGGGCGTGGTG
GACTTGTCAACTAACCAGATCTGACGGGAAGCGCTCGATAGCAGTGGCTCGGCTAGTACATAGTGCTTCGGGATGACAACTGAAATGTGGCGGCAGCCGC
CTGTTTTGATCGAATGAAGACGACAAGAAGTGAAGACCTCTTTGTATGCTTTGATGTTTGGGAGTATCATTGTTTTGGGGGTTTTGATTAATGGAAGAAG
ACATGAAGTAGATATATTTTTTCATGGTTTTATGTTTGTTTTGTTTGGATTTGAAGAGATGAAGAGATTGCAAGGGGCAAATAGTTTGGAAACCTCTAGA
ATATTCTAGAGATGAATTTGTTTTCTAGGTTTATTTATGTTTTACTATCGGTAGTTCTCTTATATTTATCTTAATCTCTAACTCTGTCACGTGGCCTAAT
AAGCCCCTTTTTTCCCTTTTGTAATTCGTTCTGCCCCTATATAAGGCACTGGATGTGTTTTGTAAAGCAACAATGCAAGTAAATATTTCAGGATCGATTG
GTAATAAGAAGATACTTATGGATTAAATTCAGTGCCCATGGAAACTGTTGCTAATCATTTCGCAGGACAAATAGGCTAGTAAGCAGTAGTAATCTAAAAA
TGAAGTTGAATCAGCACGAAACAAGGGCAGGAAAAATCTAAGATATGCTCGCTCATGTTGAAATTCAGAACTAATTGCCCAATATTTTCAAGCAAAGAAA
CTTCACTGAAAATTTTGCAGTGTCGACAGTCTATTGTCTTCAATGTGATATTACAAGCCACAGCATAAAAATTTGTACAGTTGAATCAGCACTAAACAAG
GACAGGAAAGTTCTTCCTCACTCTTGGGACTGATAGGTGATAGCTGATGTTCTGAGCTATGCTCGCTCGAAATCATATTCAGAACTAATTGCCCAATGTT
TTCAAGCAAAAAGACTACTTGATACAACGAGGTAAAAATTCACACAAAGAGAAAGGCCAAATTTTCCAGCAGACATAATCAGAAAAGTTTGATCACAGCT
ACAAACTAGCTAGATGGAGTACAAAGCAAGATTCAGTGGAATCAATCTAACCTGAGCTGCAGACGATCAGAGCGTCTAGAAGAGCAGAGCTGGCGAGACG
ATCAGAGCATGTGAGGTTTAAGATAGGCAACGAAGAAAATATAAAGCACAAAGCCACTAGCCTCAAATCTCAATCAGATCCTTGTCTGTTTCTCTGAACT
AGCCGCCGACGACTTGACGCGAA