Detailed information on CNT30104027


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001517, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30104027

Peptides detected in this lncRNA

>peptide 1 (53 aa)
MQKRYIEICLVSPFFWTACDAVHLNLCLVERLLVSKPVLVGSSVQFDLSCSCL*

>peptide 2 (38 aa)
MSDGRKGAEEPATRRVAARRAADAREGCVWGSTRNRHQ*

>peptide 3 (43 aa)
PSSLPIFTLPLRPPLDLDAPTSAQATADGVRRVGGLLAGGLRV*

>peptide 4 (30 aa)
SLLPAYLHSPPATAARSGCADFGSGDGRRR*

>peptide 5 (80 aa)
MDGKARRSLQPGGWRPGERPTPVKAASGAPPGIATNSRLSRFRSERQLTSATLWNWRIPVTARAHCWPGLSTSSLLAAAA*

Sequence

>CNT30104027
ATCCCTCCTCCCTGCCTATCTTCACTCTCCCCCTGCGACCGCCGCTAGATCTGGATGCGCCGACTTCGGCTCAGGCGACGGCCGACGGCGTTAGGCGCGT
TGGCGGCTTGCTGGCTGGCGGGCTGAGGGTGTGAGGTAGGCGGCGTCGCGAATCGCGGGCGCGCACAGCGGCTGCGCCGTGCCCATGAGCGATGGACGGA
AAGGCGCGGAGGAGCCTGCAACCAGGCGGGTGGCGGCCAGGCGAGCGGCCGACGCCCGTGAAGGCTGCGTCTGGGGCTCCACCAGGAATCGCCACCAATA
GCCGGCTCTCACGCTTCAGATCCGAACGCCAGCTGACCAGCGCCACCCTCTGGAACTGGAGAATCCCAGTCACTGCTCGTGCGCACTGCTGGCCCGGCCT
CTCGACGTCCTCCCTTCTGGCAGCCGCTGCTTGATTGCTTGTCTTTTGCAGTGAACTATGATTTTGGTGTTGCGGCCTACTCAGTGCTCACCCATCACAC
TCATACCTGAGAAACTGGTGCTATGAAAATCTGCATATTGGACTGTTTATGCAATCATTTCAAAAGCAGATCATTTATGTCCTGATGCCGCAGTCATCTC
TACTTCACTAGTTGAGTTAAGCAATCGCTAATTGCTTGGAAAACTAGGAAGCACAATATAGCTGAAGGTCCAGACAGGGGTTTGACATCATGGCTTAGAG
CAATAGTACCATGCCATTTTAGAGTGAAGTAGTATTCCCAGGATGCAAAAGAGATACATTGAAATTTGCCTAGTAAGTCCCTTTTTTTGGACTGCTTGCG
ATGCCGTTCATCTAAACTTATGTCTGGTTGAACGGCTTTTGGTTTCTAAGCCTGTACTTGTAGGAAGTAGTGTTCAATTCGATCTCAGTTGTAGCTGTTT
ATGATATTTGTATTGCTATTGTTTGATACCATATTGTTGTCAAATTGATTAATCGAATGAATATGTATGTCGATGCATTTGAATC