Detailed information on CNT30103974


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697342Oryza rufipogonOryza sativa99.1393.8496.28457forward

Expression of CNT30103974

Peptides detected in this lncRNA

>peptide 1 (85 aa)
MAIISKKNNRMALGCLVAFVILAVALSSCKADESTDVCFYAGLRACQVRMCGAYCLKYYGNLVEWKGAYCNEQGKCCCKARSISR*

Sequence

>CNT30103974
CTTATCAAATCATCAGGAGAACAAAACACTATAGCCTGATCTTGTGATGGCAATCATTTCCAAGAAAAATAACAGAATGGCCCTCGGCTGCTTGGTGGCT
TTTGTGATCTTGGCTGTCGCTCTCTCATCCTGCAAAGCGGACGAGAGTACAGATGTGTGTTTCTATGCGGGTCTCCGGGCATGCCAAGTGAGAATGTGTG
GAGCCTACTGCCTCAAATACTATGGTAATTTGGTAGAATGGAAAGGCGCCTACTGCAATGAGCAAGGGAAATGCTGCTGCAAAGCAAGATCAATTAGTCG
TTGAATAAATCAATTAGTGTCCACCTAATCGATCAATCTTGTTGAGACGGATTGATAAAAACAAAAACTGTATCAATTACAAATAACATGACGTAGGGCC
TGCATGCCAAATCGTGTGGCAGAGGTCGGAAATGTAATATATTTATATTATTAAAAAGCAG