Detailed information on CNT30103942


BLAST search results

BLAST vs Swiss-Prot:
sp|Q2QYL2|NLT2B_ORYSJ, E-value = 5e-34

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676413Oryza rufipogonSetaria viridis44.7135.589.31131forward
CNT30524155Oryza rufipogonSetaria italica49.1531.7989.58144forward
CNT30471439Oryza rufipogonSaccharum spontaneum49.1554.1493.75144forward
CNT30151138Oryza rufipogonBrachypodium distachyon44.0343.5886.05129forward
CNT30117813Oryza rufipogonOryza nivara102.0572.7597.99299forward

Expression of CNT30103942

Peptides detected in this lncRNA

>peptide 1 (84 aa)
MLTPHLEGMLAALPALRPLMLPATFLRQLQAVRRSALTWPQLMAAMVVCGPARSRAATRATNTSCARAISILVVCADDRSTCCCC

>peptide 2 (87 aa)
GAVDGGADGVGDADAALGGDAGGIAGVEAADAAGHVLEAVAGGAAVGVDLAAADGGHGGVWARQEQSCHEGDQHQLCTGHLDLGRVC*

Sequence

>CNT30103942
CTGGAGCAGTCGATGGAGGGGCTGATGGTGTAGGGGATGCTGACGCCGCACTTGGAGGGGATGCTGGCGGCATTGCCGGCGTTGAGGCCGCTGATGCTGC
CGGCCACGTTCTTGAGGCAGTTGCAGGCGGTGCGGCGGTCGGCGTTGACCTGGCCGCAGCTGATGGCGGCCATGGTGGTGTGTGGGCCCGCCAGGAGCAG
AGCTGCCACGAGGGCGACCAACACCAGCTGTGCACGGGCCATCTCGATCTTGGTCGTGTGTGCTGACGATCGATCGACTTGCTGCTGCTGCTG