Detailed information on CNT30103930


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000427, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697923Oryza rufipogonOryza sativa63.87100.07931501forward
CNT30552893Oryza rufipogonOryza glaberrima73.7465.9792.51733forward
CNT30596220Oryza rufipogonOryza meridionalis6.9424.9285.89163forward
CNT30370799Oryza rufipogonOryza glumipatula31.2397.3586.65734forward
CNT30109864Oryza rufipogonOryza longistaminata79.1596.9393.491860forward
CNT30577378Oryza rufipogonOryza barthii74.7774.3991.81757forward
CNT30118054Oryza rufipogonOryza nivara48.98100.3592.791151forward
CNT30550878Oryza rufipogonOryza brachyantha9.0221.0181.6212forward

Expression of CNT30103930

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MLIPIVKLFCLQIKLHAMMNILLVIMPCL*

>peptide 2 (29 aa)
MPDRSIEPKSWEDRTLAASSTSLPLSDCH*

>peptide 3 (46 aa)
MHFVEHLGRVLHLLLRSTTVADLRRPAVSRICISVSREATYAASRR*

>peptide 4 (36 aa)
PHLPIGGHYHCPSLPIMSPLHLHHIAISSPLAETVG*

>peptide 5 (53 aa)
MTPRVHEDVSSWSGYCQNEVVERLCRGKSHSLGRRLMCWESRGVRVKCTSTAV*

>peptide 6 (53 aa)
MCVPTTDPGIGTNKHNRFPIYKIRGRQCQKRVDVKTRGQRDLLNSSAGPKACL*

>peptide 7 (32 aa)
PAPPYRRPLPLPVAANHVAIASPSHRHLVAPS*

>peptide 8 (34 aa)
MICERKNETKQLFSTGWLEDLGGVRKRLAPSLVS*

>peptide 9 (30 aa)
MIFQNLALRKVTIATPCIILYITIFCVVVG*

>peptide 10 (34 aa)
MIGVRFYSRSRSPVDYLWLVNRALILFCLPLLFL*

>peptide 11 (31 aa)
ARTSLSAAITTARRCQSCRHCISITSPSRRP*

Sequence

>CNT30103930
GCCCGCACCTCCCTATCGGCGGCCATTACCACTGCCCGTCGCTGCCAATCATGTCGCCATTGCATCTCCATCACATCGCCATCTCGTCGCCCCTAGCTGA
GACCGTTGGATAGGGTAATGTGGTGTTTCTTCCCCAGCTAGCACTCCCTCTTCTGGAACCTTATCACATAGGCAATCATGCCCGATCGAAGCATTGAACC
CAAATCCTGGGAGGATCGAACCTTAGCCGCGTCGTCCACCTCATTGCCCTTATCGGATTGCCATTAGAACTCTAGCTCAGCTATTGTGTGTTGGCATCCT
TATCCTCCACAGTTTCCTTACACCCTAAGCTAAGCTCTCATAAAAACCTCATCCGTCTCTGCCTTCTTCCTGGAATGCATTTCGTCGAACACCTTGGGCG
CGTGCTGCACCTTCTTCTCCGCTCCACCACTGTAGCCGATCTTCGTCGTCCCGCCGTCTCTCGAATTTGTATATCGGTTAGTCGTGAGGCAACGTATGCA
GCTTCCAGGAGGTGAAGGTTGATCAAGAATATATCAAGAATAAGAACTATCCTGAGCAGGCAAGTCATCACCCCATCCCTTGAGCATGTTGATCCCAATT
GTGAAATTGTTTTGTTTGCAAATAAAATTGCATGCAATGATGAATATCCTACTTGTTATTATGCCATGCCTTTGATTATTGTTTATCTCATTATTTCCTT
GTACCAATGATTACGTATGAGTCCTTAGTCAATTATGACAAAAGCTTAGTAATGCTACTTTAGAATCATGTATTCTCATATTTATCAAATGCTATATGCT
TGGGCAACTACCTTCTAGGGAAGGTAGTTGAGATACGGCATGTGGAGACATGAGCGCCACATTGCCATGACATTGGTGACATGATTTGTGAAAGGAAAAA
TGAAACTAAACAACTATTTTCGACTGGGTGGCTGGAGGACTTGGGTGGTGTTCGGAAAAGGCTAGCGCCGTCCCTGGTCAGTTAAGGACCGAGCCATGAA
GTTAAGCATGAAACGACCCCCGTACAACCGTACTTCTCGTGTGGGTATAGACCTAGCGGAGTAAATAGCCGAGCGGAGGCGGTACCCAAGCCATAGTGGT
TTTCTTGTTGTGTGTGAGACAGGGCCTACGGTGGGGCAGCCATTGGTAGGACCACGTAGGGTGGGTGCCTACAGTGGTGTCGCCATCGGTAGGACTGCCA
TGTGTAAACCTAAACTTAACTATAACTTAGTGCATGTGTGAGTCTTCCTTTCCCGGGAGCGCCAGAACTCCTCTCACTGCTAGAAACTTATGACGCCTAG
AGTGCATGAGGATGTAAGTTCATGGAGCGGGTACTGCCAAAATGAGGTTGTTGAAAGGCTTTGCCGTGGCAAGTCTCATTCGTTGGGACGTAGACTCATG
TGTTGGGAAAGTCGCGGAGTACGGGTAAAGTGTACATCCACTGCAGTGTGAGTAAACCAAATCTATTCGAATAGCCGTGCTCGCGGTTATTGAGCACCGA
GACATGTATTACACTTGGCTAGACTCTAAATTCTTAAACTGATTGGGTGGGATGTTGCATGATGATTTTGTATTGGTGGATCAACTTCTCGAAAGGCGAG
AAGAGGTAGACCCCAGAAAACCATGACGACCAGTAGCGGGAAGCTATCCTTGGGAACACAATGGATGGTGGACAGAACCGTCGCTGTTTAATGAACAATG
GAGTTAAAACTTGATCAGTTTATGTTAGGTCTTAGGTTTGTGTAATGATATTTCAAAACTTAGCTTTACGCAAAGTAACCATAGCCACTCCTTGTATTAT
CCTGTACATTACTATATTTTGTGTGGTGGTTGGCTGAGTACTTTTGTACTCATTGTTGCTCTATATATATCTTTTAGCGGAGTGTTGAAGAGAAGCCCTT
GTTAGTACGCTTGCGTACCTAATAAGATGATCGGAGTGCGGTTCTATTCTAGGTCTCGTTCCCCAGTCGACTACTTGTGGCTTGTCAATCGGGCCCTTAT
ATTATTTTGTCTTCCGCTGTTGTTTCTCTGATAGTTGTTGGCCTGCCTGGCCCTAATGTAAGCATTTAACTCTCTTAGCCTGAATTCATTCGTGATATGT
TGTGATTCGGCTATATATGTGTGTACCAACTACCGATCCAGGGATTGGTACTAATAAACACAATAGATTTCCGATTTACAAAATCAGAGGTCGACAGTGC
CAAAAGCGTGTTGATGTAAAAACACGAGGCCAGAGAGATCTGCTTAACTCCAGTGCAGGTCCAAAAGCTTGCCTTTAGGTATACGAACGTGCCAGTTGAT
TTGATCCTGCAATCAACAAGAAACAAAGACAAAGAAACCACGGTTAAATC