Detailed information on CNT30103923


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697003Oryza rufipogonOryza sativa10060.6499.83604forward
CNT30578339Oryza rufipogonOryza barthii85.698.8594517forward
CNT30117663Oryza rufipogonOryza nivara53.1598.4799.69321forward

Expression of CNT30103923

Peptides detected in this lncRNA

>peptide 1 (58 aa)
MTRFSQTTSYLRMASQVTHTRGLVMVILPFELLPRTIVRHLLVPICHVLEVMYSFCPL*

>peptide 2 (73 aa)
MKSALLLVILLTTTALATGVLAAYNDPLQPDYLLPSDGKPGYPYTRFSNGDPSIRASSPYHRPSPPCSHLPCP*

>peptide 3 (40 aa)
SKLSRHSFNFFPIAYQYEECPFTRNPADDDGACYRRPRSV*

Sequence

>CNT30103923
ATCTAAGCTTAGTAGACACAGTTTTAATTTCTTCCCGATAGCATATCAGTATGAAGAGTGCCCTTTTACTCGTAATCCTGCTGACGACGACGGCGCTTGC
TACCGGCGTCCTCGCAGCGTATAATGACCCGCTTCAGCCAGACTACCTCCTACCTTCGGATGGCAAGCCAGGTTACCCATACACGAGGTTTAGTAATGGT
GATCCTTCCATTCGAGCTTCTTCCCCGTACCATCGTCCGTCACCTCCTTGTTCCCATTTGCCATGTCCTTGAAGTGATGTATTCCTTTTGTCCTTTATAG
TCTTAAAATATATTACATCTATACTAGATTGTACTTATATATTAGAATGAAAGGAGTAATGGTCACATTTTAAATAGAAGATTAGTTTGTCGAAGGAAAA
ATGACATTTATTAGGCTTGTATGCTTGTACTTATAATAAAGTACTTATATTGGTGCAGTGTAGTGCAAAAGTTATCAACAAATATAATAAAATAGTTTTT
ATTTCTTTGAGAACCACAGATTAAATAAAGGATGTCCTTCTGACTTTCTTTTTGTCCCCCGTCTTGTCCCCTTCTCCCCAAGGCTATGACTACGGCAACC
AGGC