Detailed information on CNT30103842


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005738, E-value = 6e-67

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555925Oryza rufipogonOryza glaberrima38.5971.2692.7548forward

Expression of CNT30103842

Peptides detected in this lncRNA

>peptide 1 (71 aa)
AAFLPPPAPSLRRRRWCSVAGRHHHRRRCAAAPFSAAVRWIDLQSSSSQQLGGRAGRAEKSRNWEEERQGT*

>peptide 2 (41 aa)
CRVSTTTGAVSTPPPLVQCRRSPPPPSPLCCCSVFCCCSVD*

>peptide 3 (51 aa)
LPRFYHHRRRLYAAAVGAVSPVATTTVAAVLLLRFLLLFGGLICRAAVANN*

Sequence

>CNT30103842
CTGCCGCGTTTCTACCACCACCGGCGCCGTCTCTACGCCGCCGCCGTTGGTGCAGTGTCGCCGGTCGCCACCACCACCGTCGCCGCTGTGCTGCTGCTCC
GTTTTCTGCTGCTGTTCGGTGGATTGATTTGCAGAGCAGCAGTAGCCAACAACTAGGGGGCAGGGCAGGAAGAGCAGAGAAGTCAAGGAATTGGGAGGAA
GAGAGGCAAGGTACCTAATGACATCGATCAACATGGGGCGGGAGTAACTCCCTTGGACTACACATTATTATTGCACACAACTGAAATTTAGTTTTAGATT
ATACTTTGCTCAGCATAAGTTTTGCATAGAAGTTGTAAGGGTCATTAAGGTTCTGATTCTTATTTTTCACGTGGGATTTGTGGAGCTAGGATGGTTTGGA
TTGTGTGGATTATATCGGTATTGACTTTTCTTATAACTGCCTGTCGTGGATGTCCATATTTTTAGGGGAGACTGGCGAAATTTCTAATAATTTTAGGATT
AGTTTTTGAGTGTATTTTGGTATGGCATTCTAGGTACGTGGTTACTGGGGGTGTTACAGCGTCAACCAAGAATCATGCCATGATGTGATTTCAGTTCCAT
TTTAATCTTCTAATTACCTGCCATGATTTTAGGTGACTGATATCTGGTTCCCTTCTCTAGTTCTCTTGTTCTGCAGCTGCTCCTCTGGATTCTGATTCAA
GGATTCTCCCGATGGAACTCTAATTTCTCCTCTTTAAACTCGGGCACCTCCAGATTGATTTGTACTATGGCATACTAATCCTGGAACTAAAACTCCTTTC
TTTACTTGAAACTCAGGTACTTCTTCTTGGCTCTTGCTCTACTGGTACTGCTTCCTGCCATCTTTCTTGATCTGCTGACTGCTACTGCTATGGTTAATTG
ATGTATTGATTTGTGCTGGATTTCACTGAGCTACTACAGCTGTTGTTGCTCTTCTAAGCGGAGCCATACTACTCTACTACTGTTGCAACTGCTGCTAATG
CTGTTCCTCGAGCTGCTTGCATGTCGGTTTGGAAAAGGATTTGCTGCCACCTCATTTTTCACCTAATCAATTTGGGGTGAAAAAGGAAATTGGTTTTATA
CGTATACCTATGGAATTCTTACATTCTAGTCCTTAAGGTTTCATAATATTTAAGATTTTACTAGAGCTCGAGGGCTGATTGGTAATTGCTCTAGTTTTAT
TTTCATTTTCACAATTCCTCTATTGATTTGTATATAATAGCTATGAGTTGAGTATGTTACAGAACATTTGCAAAGCATAATATGGATGTATGCATGCATG
CATGTATGCAGATATACACTGATCATTTGTGAATAAAGTGTCGTAACTTCTATTGTGATTTTTATTGTGCATATGTGTATCTCTCGGTGACTACTAATGT
GCGCTATAATTCATGGGTAG