Detailed information on CNT30103835


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30295213Oryza rufipogonTriticum aestivum42.3836.7886.7203forward
CNT30137065Oryza rufipogonLolium perenne42.3844.4285.71203forward
CNT30353507Oryza rufipogonEragrostis tef43.2216.285.02207forward
CNT30597113Oryza rufipogonOryza meridionalis97.9162.5397.65469forward
CNT30498372Oryza rufipogonDigitaria exilis44.4744.8484.04213forward
CNT3039554Oryza rufipogonMarchantia polymorpha20.4626.7893.8898forward

Expression of CNT30103835

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MKNPSMENMASRPFLISFTFSSAAWSGSLASPS

>peptide 2 (60 aa)
KIQGNHSAMSTMMKTTSRQFTQVANISQPQIQTLGPSYQKIRMNRFSNSSPNSTIIYTYI*

>peptide 3 (82 aa)
KNPGKPFSNVNDDENHFETIYSGSKYFSATNPNTWSFLSEDQNEQVFKFISQLDDNLHVHLTHSSTLLKLLPSSSRVRLKLT*

Sequence

>CNT30103835
AAAAAATCCAGGGAAACCATTCAGCAATGTCAACGATGATGAAAACCACTTCGAGACAATTTACTCAGGTAGCAAATATTTCTCAGCCACAAATCCAAAC
ACTTGGTCCTTCCTATCAGAAGATCAGAATGAACAGGTTTTCAAATTCATCTCCCAACTCGACGATAATTTACACGTACATTTAACACATTCTTCCACCC
TTCTCAAACTCCTCCCTTCTTCTTCCCGGGTAAGATTAAAATTAACTTGAGGCCAGCCAGCGTCGCCGGCGGCGAGATGTTTACAGGCTGGGCGTCCTCT
CGGCGGCGCCGGAGATGACGGTGAGCAGGTTGTTGCCGAAGGGGTTCTCGACGGGGCCCTCGCCGGTGACGTAGGCCTGGATGAAGAACCCCAGCATGGA
GAACATGGCCAGCCGCCCGTTCTTGATCTCCTTCACCTTCAGCAGCGCCGCCTGGTCCGGGTCGCTCGCCAGCCCCAGC