Detailed information on CNT30103780


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30577958Oryza rufipogonOryza barthii95.2335.6399.54439forward
CNT30117747Oryza rufipogonOryza nivara73.5410099.41339forward

Expression of CNT30103780

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MDSSFNLSPRRREILAPPLQVSVVLFALRTRDAAKKEFKLLANVSKL*

Sequence

>CNT30103780
TTTCAGTCTTGCAGTTTTTTTTATCTGTACTTTGTACTTCAGCGTATGAATTATCATGGATAGTTCCTTCAATTTGAGCCCTAGGCGTCGTGAGATCCTG
GCTCCGCCACTGCAAGTCTCTGTTGTCCTCTTTGCTCTCCGGACCAGGGACGCTGCCAAAAAGGAATTCAAATTGCTCGCCAACGTCTCCAAGCTGTAGA
TGGGCCATAAGCAACCAAGCAAAGGTTCTTGAATTTGCAGCCGATCTCTCGCCCTTTTTAGGGTTCTATTCTTGTAGTGGTCATTTCTGTAAGTAATGCT
GCCAAGAAAGAATTTCAAGGTAGGTTCAGCAGTGCCACTGACCGGCAACATTTCAGGGTGTCTCACCAAAAGGTAGAGCATGTAGTTGGATAGTTTCCGG
CACACACTGGCCAATACCTCATGAAGATAATAGTTCGATAGGTGCACCTCTGTAAATATAT