Detailed information on CNT30103707


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT001044, E-value = 2e-61

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696654Oryza rufipogonOryza sativa25.3710099.63536forward
CNT308847Oryza rufipogonZea mays3.9837.8489.2984forward
CNT30720151Oryza rufipogonTriticum spelta4.0221.9689.4185forward
CNT30371153Oryza rufipogonOryza glumipatula31.5273.2797.6666forward
CNT30107258Oryza rufipogonOryza longistaminata21.5329.5886.59455forward
CNT30577843Oryza rufipogonOryza barthii31.2887.5598.94661forward
CNT30117763Oryza rufipogonOryza nivara38.2481.2998.64808forward

Expression of CNT30103707

Peptides detected in this lncRNA

>peptide 1 (62 aa)
SHLRLRLRARRRSVRVVFAARSESGSPRSSIVFRYLTPAHTPPPFPSCTQPFHLLCSTPPPT*

>peptide 2 (41 aa)
MTHNRAVSYSLWGASVVVISLALALMSKKTLILNVIHTYVL*

>peptide 3 (67 aa)
QPPASASACQAAIGTSSFRCQIRIRFSSLVDRLPLLNPRTHTAPISILHTAISLALLHASTYLNRSH*

>peptide 4 (35 aa)
MLSKLLINIFFFQNFYAKVTLENRINIFFIKKTNT*

Sequence

>CNT30103707
CAGCCACCTGCGTCTGCGTCTGCGTGCCAGGCGGCGATCGGTACGAGTAGTTTTCGCTGCCAGATCAGAATCAGGTTCTCCTCGCTCGTCGATCGTCTTC
CGCTACTTAACCCCCGCACACACACCGCCCCCATTTCCATCCTGCACACAGCCATTTCACTTGCTTTGCTCCACGCCTCCACCTACCTAAATCGCTCTCA
TTAGTACTCAATTAAGTCGATCGGCGAGCGATTCAGCGCGGCTCCTCGACCGATCTCTCCGTTTCGTCAGATCGATCGATCGATCGATCAGGGCTGTGTA
TTGCGCCGTGTAGTACGTGAGAGGATCGGAGTCGGAGCAGCGAGCGAGATTTGTTGAAGCAAATTAAGTAGATCGATCTCATACCGATCATCCTTAATTA
ATTTATCATGGAGCTGGTGCTGGTGATATCGCTGCCGCTGCTGGCGCTCATCATAATCGTCGCCATCGTCCTCTGCGTCATCTGCCGCTAGCTTAGCTGA
TTCCTTCCTGCCTCCGCGATCATTTTGCATACACGTAGTATGTCAGTATGTGGTGCATCAAATGTGATCATTTTGCCGCCCGTTGTTGTTGGGCACGGTG
ATTGACGACAGAAAGAATTACTCCCTTCATATTTTAATGTATGACACCATTGACTTTTTAACCAACGTTTGACCATTCGTCTTATTCAAATTTTTTATAC
AAATACAAGAATATTTATGTCATGTTTAAAGAACATTTGATGATAAATCAAGTCACAATAAAATAAATGATAATTACATAAGTTTTTTAAATAAGACAAA
ATGTTAAACGTTTATTAAAAAATTAATGGTGTCATACATTAAAATACAGAGGGAGTACTAGAGAACACATGGCTTCTTGTTCCTTCTTTGGCCTGGTATG
GTGTGAGTCGTTGTGACTAGTGTGCTCCCAATCCAGGCTGCCTATACATTTGTCCATTTCTTCTTCTTCTTCTTCTTTTTCTTCTTCTTCTTCTTCGTTT
TTCTGTTGGTTACTGATGAGTTCTTTTGCTAAGGTTTCCAACTCTACTATCTTATTTTTCACGTGTATATGCTTTCCAAACTACTGATCAATATCTTTTT
TTTTCAAAATTTCTATGCGAAAGTTACTTTAGAAAATCGTATTAACATATTTTTTATTAAAAAAACTAATACTTAATTAATCATATATTGATGAGTCAAT
CTATCCTTATATGTATGAAAGATTAGTTCACACCACTACCAACCGAACGCAGCTCTAACACGAAAGGCATCGATTCCAAGCGTGCGGTAGTCTGTCCATG
GTGAGTGCGTGAGAAGATGATCCCAACGGAAGAAGAGCACATACCGTGCACAGTACAGCTCCTGTGCTGTGTGTACGCCTAGCTGCAGGCAGCACCGGCC
GGCACGTGGCACGCGGTTTTTCTGGGCTTTTGGCCTCTTCCCCCTAGGCCCGCCACCACCCGATTCCCGGAACCCGCCCCATTTCCGCCTCCTCCTTCGC
CTTCGCGGCTTCGCCTCTCTCCCACACATGCATCGCCATCGCCGTCATCGTCAGGACTAAGCTCTGCTCTGCATCTGCACCACCACCCAGCTGCAGCCCG
AACAAGAAGACGAGCATCTCATCTCATCTCATCTGCCGATCGATCGATTCGCTGCAGGGAGAGCTGAACAATGGAGTTCGTGTTGATCATCTCGCTGCCG
CTCCTCATCCTGATCATAATCGTCGCGGTGGTTCTCTGCATCATCTGCCGCTAGCTGAATGGTGACACCTCATTGTTCTTCCTGCCCATATCTTGATGTG
AACATATCATGTATCAATTGATTAGTATCTCATGACTCACAACAGAGCAGTCTCGTACTCTCTTTGGGGGGCCAGTGTGGTTGTGATTAGTTTGGCCCTA
GCTTTGATGAGCAAAAAGACATTGATTCTGAATGTCATACATACATATGTGCTGTGAGAATCCCCTCTCTGCTTTGGTTCGTTTTTGATATTATTCATAC
GGGAGATCGGACAGCTGAAAGCATGATATTCTCATTCTCTTTGTCATTCTTCTGAAGATCAGAAGCATCATCTGCTTTGTGTTGTTCTGTACCATTTTGT
TCATGCCGCCCCA