Detailed information on CNT30103650


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555192Oryza rufipogonOryza glaberrima76.1897.7197.941794forward
CNT30107398Oryza rufipogonOryza longistaminata28.5463.4689.58672forward
CNT30577937Oryza rufipogonOryza barthii60.0897.6597.531415forward
CNT30117777Oryza rufipogonOryza nivara59.8781.2798.581410forward

Expression of CNT30103650

Peptides detected in this lncRNA

>peptide 1 (73 aa)
MGNLFFIPKHPPPPPPPSHVHSIHHPLSNAPSFMNGPNGFMMAHTLCTETRLPLDEEQMRELMKTIDKKKSEQ*

>peptide 2 (48 aa)
MINQLCSLASWREEIILLCIVRNKQNKTTNYIFDMIWFVSEVHSYHSL*

>peptide 3 (47 aa)
FYSAPANNILAISLKRKKRKKKIIWLVFKGLAPQLHPQTDRYTKYKH*

>peptide 4 (42 aa)
MIVTSQQAISDTNCDILIICTYNRGSDTICNTYHCDIPKSKA*

>peptide 5 (40 aa)
MSLALVRDFWSLMIPLIFDGDSLSEVIVTSDGPVFSGHQR*

>peptide 6 (37 aa)
MRSPVTAFVYNPSVMRNRIVLELIRDTSLFSDLLLSC*

>peptide 7 (34 aa)
MRKKAFTSAQCWKSFCFLSRTAQPEDFPFIRIFG*

>peptide 8 (32 aa)
MVCSILRVAEKIDLKITCADISPWYYVGSGYF*

>peptide 9 (38 aa)
MLNLAGSRENRPQNHMCRHQPVVLRRIRLFLMGPNPHL*

Sequence

>CNT30103650
TTTTTATTCTGCACCAGCGAATAATATTTTGGCTATTTCCTTGAAAAGGAAGAAGAGGAAAAAAAAGATCATTTGGCTAGTATTTAAAGGGCTAGCACCA
CAACTACACCCACAGACAGACAGGTACACAAAATACAAACACTGAGAAAGAAAGAAAAGACAACTGTCGTGCATAGAGAATATCTATTGTCGATCTCTAT
TAATGGGCAACTTGTTCTTTATCCCCAAACATCCTCCTCCTCCTCCGCCTCCTTCGCATGTCCATAGCATTCATCACCCTCTCTCTAATGCTCCATCTTT
CATGAATGGTCCGAATGGATTCATGATGGCACACACATTGTGCACAGAGACGAGGCTACCTCTTGATGAGGAACAGATGCGGGAGCTGATGAAGACGATC
GATAAAAAGAAGAGCGAGCAGTGATACTAAGGTAGTGGCTCAGTGTTAAGTGTTACTCCCTCCGTTTCATAATGTAAGCCATTCTAGTATTTCTCATATT
CATATTGATATTAATGAATCTAACCATATATATCTAATATCAATATGAATGTGGGAAATACTAGAATGACTTACATTGTGAAACGGAGGAAGTAACGAAT
AAAGGGAAGACAGGTCGGCCGTACATAATCTGCCGCTAGCTTACCGAAGAATTAATTATAAGATGATCAATCAACTCTGCAGTCTAGCTAGTTGGAGAGA
AGAGATTATACTACTTTGTATCGTTAGAAATAAACAAAACAAAACTACAAATTATATCTTTGACATGATATGGTTTGTCTCTGAGGTTCATAGCTACCAC
TCGTTGTAAAGTGTCATCTAATTTAAGCTAATTTATGTTTAGCTAGTATACAAACACTGATCCCACTGTCGTTTCCAAACTGACCATGGTATGCTCAATC
TTGCGGGTAGCAGAGAAAATCGACCTCAAAATCACATGTGCAGACATCAGCCCGTGGTACTACGTCGGATCAGGTTATTTCTGATGGGTCCAAACCCTCA
CCTTTGATGAGTTTAGCCCTAGTCAGAGATTTCTGGTCACTGATGATTCCACTCATCTTTGACGGGGACAGCCTATCAGAGGTGATAGTCACATCTGACG
GGCCAGTATTTTCCGGCCATCAGAGGTGAGGGTCTCCGCAAGCCTAGGGGTGGTTACAACCCATTAGAGGTGAGACGCCTGTGACGGGTCTAAAGGTGAC
ATCCCGTGTACCCATTCTATGACGTATCTACCTTGATGCCCGTCACAGATAACTCACCTATGACGGGTTGAAGTAGCACAGATGAGGTCACCTGTGACGG
CCTTTGTTTATAACCCGTCAGTGATGAGGAACCGCATCGTCTTGGAGCTCATCAGAGACACTTCTCTCTTCTCCGATCTCCTTCTGAGTTGCTAGCATCC
TCTTGCAGTTGCATTGTGTCTCCATCACTTGGTTCCATTTTTTTGGGTGCAAATCTTCTTCTAATGCAACTACAGGTTCCTATTTTTGTAGGTGCCATAT
AGATTATTCTCATAAATCTTCTCCTCAATCTGAATTTTCCTGTTCCTATTCGATATTCTGCTCTAATTTGTTTTGAAAAATGATGTCTGAATCTGAATTG
ACTATTGGTTTATCCAGTTTTGTAGCTTCAGATTGAGATTTGGATCTGAAATTTCCATGTATTATTCAGTGTTCATGCTAACTTTTTTATGAGAAAGAAA
GCTTTCACTTCTGCACAGTGCTGGAAAAGTTTTTGTTTCCTCTCCCGAACAGCTCAGCCAGAGGATTTTCCTTTCATACGTATTTTTGGGTAACCAAAGT
TACCCATGATTGTGACATCCCAGCAGGCTATAAGCGATACAAACTGTGACATACTAATTATATGCACTTATAATCGTGGGTCTGATACTATTTGTAACAC
CTACCATTGTGACATACCAAAGTCTAAGGCTTAAAATAGTCACACACGTGTAACCATACCATACTAGATACAATTAATGCCACCAACGCCTAGGATATAA
ATTAGTCACACGCATATAACCATGCTATGATACCATTTGAAACACCTAGGGTATAAACCTAAGCCCATATCAATTTATTGGGTCATACCTTTATTGTAAA
TTTTTACGTTTTTACCCTCGCTTCGTGCAAAAGCAGTTCAAACCGGTGTTATTAGAGCTTGGAATTCAAGTCTTGGTAGAAAATTGAGCACGCTTATTGG
CGTGCTTATTTTATAGCCCATGCATTTGTTTTCGTGTTATTAAAAAAAGTATTATGTTTGTTAAAAAAACGACTTCCTCAAATTTTGACATCTTAAATTA
TTAAATTGTAAATATCTTTTTAATAGATTTTTATGAAAACTCTCCTATATAGCTG