Detailed information on CNT30103646


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002948, E-value = 8e-145

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30523179Oryza rufipogonSetaria italica24.1667.7591.98187forward
CNT30596024Oryza rufipogonOryza meridionalis32.6994.0598.81253reverse complement
CNT30370879Oryza rufipogonOryza glumipatula29.8410098.7231reverse complement
CNT30646316Oryza rufipogonCannabis sativa10.2120.7387.3479reverse complement

Expression of CNT30103646

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MGDRPGNSSRVHTSEDKVCRKDMCWSVRAVYDL*

>peptide 2 (36 aa)
KINRILISTSCNFFSGSQSPKNSRVKRAWPGAIWDG*

>peptide 3 (54 aa)
MKAIRCKWARPGGRRDVTKWYQNSMAHALALDTWTWLREDVPGLGLIDGGVDLS*

>peptide 4 (67 aa)
RLIEYSYQQVATSFPEANLQRTPGLSVLGLEQFGMGDRPGNSSRVHTSEDKVCRKDMCWSVRAVHDL*

Sequence

>CNT30103646
TAAGATTAATAGAATACTCATATCAACAAGTTGCAACTTCTTTTCCGGAAGCCAATCTCCAAAGAACTCCAGGGTTAAGCGTGCTTGGCCTGGAGCAATT
TGGGATGGGTGACCGACCGGGAAATTCTTCCCGGGTGCACACGAGTGAGGACAAAGTGTGCAGAAAAGACATGTGTTGGTCTGTGAGGGCAGTCCATGAC
CTATGAAAGCTATCAGATGTAAGTGGGCCCGGCCTGGGGGAAGGCGGGACGTTACAAAGTGGTATCAGAACAGCATGGCACATGCGCTGGCACTGGACAC
ATGGACGTGGCTAAGAGAGGACGTTCCTGGCCTAGGGTTGATCGACGGGGGCGTCGATCTCTCTTAAGGGGGTGAGGGTGTAACATCCCGGACTAGAACT
TAATAGGATTAATAGAATACTCATATCAACAAGTTGTAACTTCTTTTGCCAATCTCCAAAGAACTCCAGGGTTAAGCGTGCTTGGCCTGGAGCAATTTGG
GATGGGTGACCGACCGGGAAATTCTTCCCGGGTGCACACGAGTGAGGACAAAGTGTGCAGAAAAGACATGTGTTGGTCTGTGAGGGCAGTCTATGACCTA
TGAAAGCTATCAGATGTAAGTGGGCCCGGCCTGGGGGAAGGCGGGACGTTACACTTAGTTTGGCTTGCTGCTGAGAATACTGAGTTTAGTGCTCCCATTG
TCGATGGTTTTATTTTTGCTGAAATACCTGATGTGTTGACTGATCCTTTAGGTTATGCTTTAGTTGATGAATTT