Detailed information on CNT30103565


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT000921, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555074Oryza rufipogonOryza glaberrima19.7933.1499.57461forward
CNT30107694Oryza rufipogonOryza longistaminata61.3195.8489.641428forward
CNT30577878Oryza rufipogonOryza barthii9031.3598.472096forward

Expression of CNT30103565

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MTRVSQPVLSKNPGNTRTPLAADNVTFRACGD*

>peptide 2 (33 aa)
MVDFRVASTVPTDIRLPSTCEEHTSTTAILVWA*

>peptide 3 (32 aa)
MWLPPGSPDSGVHRVNRRWLRSLAISVHSLNS*

>peptide 4 (42 aa)
MEQVPLMLVTEKLCHDKANVFGTSWIAGKAYIYCSMNIIKTI*

>peptide 5 (51 aa)
MDSNLWYFKHQIIRLPISDLFALEQGKLLFLSFEHNNPIFYISSIFCISHT*

>peptide 6 (59 aa)
MNYEPICYPISASTREQLNPSHSSTKAQPRPILATYPLNQLDYSVYLLLSKKPKPTQEI*

>peptide 7 (31 aa)
MVESSRAWQHRLLCSAQPLKLNGSLGRRPVC*

Sequence

>CNT30103565
CCATCCCTCTAGCCGTTATATTGTCTATCGACACCGGCTAGAGAAGATACCAAACCTAGTCGTCATGCTTTAGCGACGACTAGCGAACACCCAAACCCTA
GTCGATATTTATCTTACCTCGATATCGGCTTAGACAACTGAAACCTTAGTCAACTTATTTTCTAGACTCCCCACCAGCTATAATCACAACCATTTACCTG
CCTACTACCCATAGCCTATGCATGAATTACGAGCCGATATGCTATCCTATTTCAGCATCGACTCGAGAACAACTAAATCCTAGCCATTCTTCTACCAAAG
CCCAACCTCGACCAATACTAGCCACATATCCACTTAACCAGTTAGATTATTCGGTATATCTCCTACTCTCCAAGAAACCAAAACCCACACAAGAAATATA
AGCGACAATTGTTGCTTAATCTCCTATCCACCTTAGCCCCCAACCCTTTAGAACCTGCACATAAAATATCAGCCCAGTAATCCATATACCTGCATAAAAG
AGATAACCTAAACCCTAGTCCTCCTAACTGTTTATCTCTTTCTTGCTATTTTATGGCTTTTATTGAATTTGGATCTTCCTCTTCTTCAGTAGAGTCTATT
TTATATGGATAGCAACCTATGGTATTTCAAGCATCAAATAATCAGGTTGCCTATTTCGGATTTATTTGCGTTGGAGCAAGGCAAGTTATTATTTCTCTCC
TTTGAGCATAATAATCCTATATTCTATATCTCCAGTATCTTCTGCATTAGCCATACATGATTTTAAATGCATAACCTGAATATATAGCAAACCAGATATA
TGCTAGATTTTGCTTAGCCATGCCTAGTTAGATTATGCATAAAATATAATAAACTTAGATTGGGACAGTACGGTAGAAATGGTTGATTTCCGGGTGGCTA
GTACTGTTCCAACCGACATAAGACTACCAAGTACATGTGAAGAACATACGAGTACGACCGCAATTCTCGTATGGGCATAGACCTAGCTGATTAAGTTATC
TAGCAAAGGCGGTACCTCTGTATAGTGGTTATTCTTAAGTCCTCGCACAGGAGGCAAACTTACACCGAGCAGGGCGATTGTGATATTTACCGAGGCGCAG
GTAAATATCTTAATTATCTCGTGAGCTGTGTGTGTGAATTATGAAAACCTGATTGAGATGACGAGGGTCTCTCAACCAGTTCTCTCTAAAAACCCCGGGA
ACACCAGAACTCCTCTCGCTGCTGATAACGTTACGTTCAGAGCGTGTGGGGACTAGAGTTCATGGAACAGGTACCATTGATGTTAGTGACCGAAAAGCTT
TGCCATGACAAGGCTAATGTGTTTGGCACGTCATGGATTGCGGGTAAAGCGTATATCTACTGCAGTATGAATATTATTAAAACTATTTGAATAGCCATGC
TTGCGGTTATCGGGCATTGGGACTCACAATGTCATCTTGGTTAGAAACATAATTTCAAACTTTATTAAATACTGTTGCATTTAAAACATTATAGACTTTC
CTTCTATATTCTCTGCTTTCTGCAAGTAAATCTAACCCTACTCGAATATTATTATTTCATGCATTCATTGTTGATTAATATAATAGCTTGCTGAGTACGT
TGTACTCACCCTTGCTTCAACCCCACATTTTTTTCAGTCCGTTTGATGTTCTTACTGAAGCCGGGAGTTCAATCATATAAGTTAATCTCATTTTAACTTA
GTTCTCAAGTATAGATTAGATAGATGGTTTAAGTCTATAGCAAAACACTAGAGTTGAGTCATCATATAGCTTCTGCTGTAATAGTTAGCCACAAGCTTGT
AAATACCCTTATATTTTGTAATATTATCTCCTTTGAAACCTTGATCAAATGTATGCAATGAAGATCCAGATCGTTGAACATGTATCAATCTACTGATCCA
GGGCTTGATACAGTCTAAACATGTCGGTTTCCGAATCATTAGTTTTGGGACCCCACACCAAATTTCTTCCTCCTTGGCATAGGTGACTTTCAATAGTCCA
CCAAGGAGTGATGGCAGGATAAAAGTGACACTTCTCTACCATGCTGAACCATCCCAGAAAGCTTCTCCGACCACTACATTCTATTTTGCATTGAGGAACG
AAATGGTCGAGTCTTCGAGGGCGTGGCAACATCGTCTTCTTTGCTCTGCGCAGCCATTGAAGTTGAATGGGAGTCTTGGAAGGCGGCCGGTCTGTTAACG
GCGCTGTGAGAGGCCCTTATGTGGCTTCCTCCGGGTTCTCCGGATAGTGGTGTGCATCGTGTAAATAGGCGGTGGCTGCGAAGCCTCGCCATCTCTGTAC
ATTCTCTAAATTCTTAATATACTACGGTC