Detailed information on CNT30103459


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006839, E-value = 4e-179

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30103459

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MSYVSCVVIALPRAARAMSDLLQLGSYPVGLP*

>peptide 2 (56 aa)
RKLAYFSLPYVFIILGKTCEYNLVLNPVSTISGEDSGYELCFLCGHCFAEGGEGNE*

Sequence

>CNT30103459
TAGAAAGCTTGCATACTTCTCTCTCCCTTATGTATTTATAATTTTGGGTAAGACTTGCGAGTACAATCTTGTACTTAACCCGGTGTCTACAATTTCAGGA
GAGGATTCCGGTTATGAGTTATGTTTCTTGTGTGGTCATTGCTTTGCCGAGGGCGGCGAGGGCAATGAGTGATCTCTTGCAGCTTGGCTCTTACCCAGTT
GGTTTGCCCTAGTGGGGTTGTGGCACCACCGGTTTTATCTTTTGCTTATGAACTCTAATTGAGACTTCCGCTGCTATATTTATGTGTTGTATGTTGGGAC
CTCGGACCATATTATGTGTCATGTACCTTACTGCACTTTAACCCTATTATGGTACTTGCTATGTTTATTAATTGCTTGCGATGAAAGTG