Detailed information on CNT30103420


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554815Oryza rufipogonOryza glaberrima59.0587.4399.69953forward
CNT30109106Oryza rufipogonOryza longistaminata16.4850.9698.87266forward
CNT30117537Oryza rufipogonOryza nivara83.2198.4699.71343forward

Expression of CNT30103420

Peptides detected in this lncRNA

>peptide 1 (44 aa)
HPLCSGEITDSSSHRASARTPFAVTPPRALSPPPLAALFPRTEQ*

>peptide 2 (95 aa)
MATSKVSRKPAGAPWAPGASARLKNELWETSMPGARSSSLLLQAPGLTKRVVSSGGMASASDPHHLLLQPYESRDVPLPLSWLCLLSIRHAISGD*

>peptide 3 (90 aa)
MSAVVSLLNGSIGRLGGLLLIWILTMEEASRELASLHLRHAASCRRRLLACNFLCAAPDLRVEAAAATGGWDTCTNHPLPRRPRRKCTTA*

>peptide 4 (29 aa)
MALPPLHPPCHLRRLMLLIKGKVIFRRAE*

>peptide 5 (30 aa)
MHKCEVCETFKSIIHGLCVTSHNTCDFVQL*

>peptide 6 (29 aa)
MKAGMFLFLYHGFASSPSAMPSQEIDASN*

>peptide 7 (35 aa)
MTAPPESAVVVQNGDGLGVESRSRVIVEVRQEESR*

Sequence

>CNT30103420
CCACCCTCTGTGTAGCGGTGAAATCACCGATTCCTCATCCCACCGGGCGAGCGCGAGAACCCCTTTCGCAGTAACACCGCCTCGAGCGCTATCCCCGCCA
CCGCTTGCCGCGTTATTCCCGCGCACAGAGCAATGACACCGGATGATGCGCCTCCTCGCGCATTGAATACCAGTGCGCACATCCTCCCCTAATAAGTAGT
GGCCGCAGGCCGCCGGTCATCTCTTCCGCCGTCGCGTGAAGGCTCGGTGTCGGGGAAGGCCACACCTGCGGGAGAGGGGCCTAGGGTTTCACGAGAGCGT
GTGCTGGTGTGGCGTCGTGGCAGTGGCCAGATCAGAAGCTAGCCGGCCGTGGTGGAGTTCGTAGTGTATCTTGGCCGCTCCGTTTCGTTGCATGTCGGCC
GTCGTTTCACTCCTCAATGGCTCAATTGGAAGGTTGGGGGGGCTGTTGTTGATTTGGATCTTGACAATGGAAGAAGCCTCAAGGGAGCTAGCGAGCCTCC
ATCTCCGCCATGCTGCTTCTTGTCGCCGCCGGCTTCTGGCATGTAACTTCCTCTGTGCCGCCCCAGATCTGAGGGTTGAGGCCGCTGCTGCCACCGGAGG
CTGGGACACATGCACCAACCACCCGTTGCCTCGGCGCCCCCGTCGGAAGTGCACCACGGCTTAACCACCCACTCCCTCCGTCCTCGCTGACTTCTGCTCC
ACCTCGCTGTCGGTTCCTCTGTAGTCGCCGATGCCGACGGCTCCACCCCCGGTTCTTCTCCACCTTCCATGACAGCGCCACCCGAATCTGCGGTCGTGGT
TCAGAACGGCGACGGCTTGGGCGTGGAGAGTCGCAGTCGCGTCATCGTTGAGGTTCGGCAGGAGGAAAGCCGGTGAAGCCGCGGCAGGAGCGGCGCGGAG
CGCGCCGTTGATGGCGACGTCGAAAGTGTCGAGGAAGCCGGCAGGGGCACCGTGGGCGCCTGGGGCGTCGGCGCGGTTGAAGAACGAGCTGTGGGAGACG
TCGATGCCGGGAGCCAGAAGCAGCTCACTGTTGTTGCAGGCACCAGGTCTGACGAAGAGGGTGGTAAGCTCCGGCGGGATGGCATCGGCCTCAGACCCTC
ACCATCTGCTGCTCCAGCCATATGAAAGCAGGGATGTTCCTCTTCCTTTATCATGGCTTTGCCTCCTCTCCATCCGCCATGCCATCTCAGGAGATTGATG
CTTCTAATTAAGGGAAAGGTGATCTTCAGAAGAGCTGAGTAAGGCTGCAGCAGAAGGTTCATTTTCCCTTTTGTGAGGTGCCATAACTTTCTGGTGTCTG
TTGAAGGACAAAGATTATAAATGACATATATTGCAGGAAAATGACATATTTTGAGTGTTTTTATATGTTGGAAACGTGCATTGCACGTGCACGATTACTA
GTATGTTTCTAAAACACCACCTTTAATAAAATCTTGATTAATTAAAAATATTGCATACACTCTATGTTTTAGAATTCAGGTAAATTTGTACTAAACATGC
ACAAATGTGAAGTTTGTGAAACTTTTAAATCCATAATACATGGTTTATGTGTCACAAGTCATAATACTTGTGATTTTGTACAACTTTAATCATAATAAAA
TATAGGGCTTTCTA