Detailed information on CNT30103374


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697998Oryza rufipogonOryza sativa28.0362.7894.33194forward
CNT30555253Oryza rufipogonOryza glaberrima29.6224.8593.17205forward

Expression of CNT30103374

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MKHKAAQEIADGSSTSDILHAAADGVCFPRGTSTAPVLLAQPQDES*

>peptide 2 (59 aa)
LCVLNTRARSVSRISIYIKVITSLHLASSSISTTPYIQFFSFSILRAHTHTGASNCCWW*

>peptide 3 (82 aa)
MAAALVTYYMLLLMVCASRVVQVQPQCCSRSHRMRAEDFPSWSCPVEVGFVAAVKDACGIESPHCRSQVFRLSSFLSFPLHL*

Sequence

>CNT30103374
CTTGTGTGTTCTAAACACGCGCGCGCGTTCTGTCTCCCGGATATCGATATATATCAAAGTTATTACTTCTCTCCATTTAGCTAGTTCTTCCATTTCCACA
ACTCCATATATCCAATTTTTCTCATTTTCTATTTTGCGCGCACATACACACACCGGCGCTTCGAACTGCTGCTGGTGGTAGTATTGCCGTATAGCCAGCC
GCCGTTTCTCCGTAGACCGTAGCTACTTTCAGGGGGGTGCGAGCGACACGTGGAGAACGCAGCTGCTCGTGGAGGAGGGGCACCACAACCACAAGTTAGT
GAGGAGAGGCAGAAGAAGATGAAGCACAAGGCGGCTCAGGAGATAGCTGATGGCAGCAGCACTAGTGACATATTACATGCTGCTGCTGATGGTGTGTGCT
TCCCGCGTGGTACAAGTACAGCCCCAGTGTTGCTCGCGCAGCCACAGGATGAGAGCTGAAGATTTTCCTAGTTGGAGCTGTCCTGTTGAAGTTGGTTTTG
TCGCTGCCGTCAAGGATGCCTGTGGAATAGAGTCGCCTCACTGCAGGAGTCAAGTCTTCAGGCTTAGCTCGTTTTTATCTTTTCCGCTGCATTTGTAATC
TTTTATATTTTTGTAAGATGTGGATCTGTATGTCAACAATTGTCGTTTGTGTATCCTGGTTGGTCCTGGACAGGGGCTTAATACACATTCAG