Detailed information on CNT30103365


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT007471, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696057Oryza rufipogonOryza sativa99.4838.3798.22957forward
CNT30369611Oryza rufipogonOryza glumipatula27.7516.1990.64267forward
CNT30117501Oryza rufipogonOryza nivara10029.1198.54962forward

Expression of CNT30103365

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MIGVRSCSRSRPPVDCLWHVNRALILFCLPLLFSGSCWPTWP*

>peptide 2 (30 aa)
MDRVLGRQLYLLIKTFYVISLEICLGKSLP*

>peptide 3 (37 aa)
MCVPTIDLEIGTDKHRRFPISKIGGLQSKMKIVAETE*

>peptide 4 (29 aa)
MLGQKSAVKTCGILDFVRDNSHVWYGHIL*

Sequence

>CNT30103365
ACAATGGATGGTGGACAGAACCGTCGTTGTTTAATGTGAACACTGGTATTAAAACTTGATTAGTCTATGCTAGGTCTTAGGCTTGTGAAAAGATTTGCAA
AACTTGCTTTGTGCAAAGGAACCTAAAGCCATTCCTTGAAATACCCTCTATCATATGCATCGTTGCTGTGGTGGCTTGCTGAGTACGATTGGTACTCACC
CTTGCTGTTTATATATCTTTTAGGAGAGTGTTGAAGAGAAGCCCTTGTCGGTACGCTTGCGTATCCAACAAGATGATCGGAGTGCGGTCTTGTTCTAGAT
CTCGTCCCCCAGTCGACTGCCTGTGGCATGTTAACCGGGCCCTTATATTATTTTGTCTTCCGCTGTTGTTCTCTGGTAGTTGTTGGCCTACCTGGCCCTA
ATGTAAGTATTTAACTCTTTTAGCCTGAATTCATTCGTGATATGTTGTGATCCAACTATGTATGTGTGTACCAACTATTGATCTAGAGATTGGTACGGAT
AAACACAGAAGATTTCCGATTTCCAAAATCGGGGGTCTACAATCGAAGATGAAGATTGTCGCGGAAACAGAGTAAGAATCGGCTGAAGTCCGGATCGGCT
ACGATTGGATCGGCTGAGTTGGAGTCAGACTTGGTTAGGTGATGCAGCCGATTCCAACAATACGACTTGGTGTACGACATCGGATTGGGTTGAGGTGCTT
CAAGATGATTGCCATGCATGGATAGAGTCCTAGGAAGGCAATTGTATCTATTAATTAAGACATTTTATGTAATTTCCTTAGAGATATGCTTGGGCAAAAG
TCTGCCGTAAAGACTTGTGGTATCTTAGATTTTGTTAGAGATAATAGTCATGTCTGGTATGGACATATCTTGTAATTCTCGGGTATAAATAGACCCCGAG
CCCTATGTAATTAAACACACACGTTCAATACAATTTCGGCGCATCGCCACCTTTTTGCTTTA