Detailed information on CNT30103353


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONSLYT002404, E-value = 6e-131

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675663Oryza rufipogonSetaria viridis32.0769.2589.13322forward
CNT30378101Oryza rufipogonArabidopsis thaliana43.925086.17441forward
CNT30282434Oryza rufipogonChenopodium quinoa39.5416.1787.66397forward
CNT3019970Oryza rufipogonCitrullus lanatus20.6268.0987.44207forward
CNT30381504Oryza rufipogonManihot esculenta38.2544.8185.42384forward
CNT30402788Oryza rufipogonBeta vulgaris26.9921.5484.87271forward
CNT30630919Oryza rufipogonVigna unguiculata58.9644.4483.28592forward
CNT30711421Oryza rufipogonGlycine max14.8451.9287.92149forward
CNT30635894Oryza rufipogonCapsicum annuum21.4138.1987.91215forward
CNT3094731Oryza rufipogonSolanum tuberosum41.2427.5886.23414forward
CNT30187559Oryza rufipogonSecale cereale23.5135.3890.68236forward
CNT30298345Oryza rufipogonTriticum aestivum45.0264.290.71452forward
CNT30224390Oryza rufipogonHordeum vulgare17.3331.6489.08174forward
CNT30394033Oryza rufipogonTriticum turgidum45.0233.4190.71452forward
CNT30560521Oryza rufipogonActinidia chinensis37.3552.1682.13375forward
CNT30510308Oryza rufipogonSolanum lycopersicum16.7365.1288.1168forward
CNT30441217Oryza rufipogonAegilops tauschii41.6356.2690.67418forward
CNT30250601Oryza rufipogonAvena sativa15.0435.5392.72151forward
CNT30665102Oryza rufipogonTriticum dicoccoides15.2436.9691.5153forward
CNT30314068Oryza rufipogonCamelina sativa62.9541.6983.86632forward
CNT304322Oryza rufipogonZea mays27.1947.8186.45273forward
CNT30227528Oryza rufipogonAnanas comosus2534.5386.45251forward
CNT30126131Oryza rufipogonCorymbia citriodora12.4521.8582.4125forward
CNT30625469Oryza rufipogonDaucus carota60.4640.5783.36607forward
CNT30721901Oryza rufipogonTriticum spelta17.1333.7388.95172forward
CNT30352420Oryza rufipogonEragrostis tef58.4794.8390.29587forward
CNT30477326Oryza rufipogonArabidopsis halleri35.6640.587.99358forward
CNT30362636Oryza rufipogonSorghum bicolor26.228.1990.49263forward
CNT30481150Oryza rufipogonChara braunii44.2231.4282.21444forward
CNT30704690Oryza rufipogonPrunus avium60.5629.9285.53608forward
CNT3055965Oryza rufipogonAmborella trichopoda21.4124.7485.58215forward
CNT30107297Oryza rufipogonOryza longistaminata29.4865.92100296forward
CNT30323609Oryza rufipogonAsparagus officinalis61.4537.0686.87617forward
CNT30149846Oryza rufipogonBrachypodium distachyon16.0436.3492.55161forward
CNT30577638Oryza rufipogonOryza barthii33.8652.4798.53340forward
CNT30584451Oryza rufipogonEchinochloa crusgalli29.3855.0490.51295forward
CNT30594767Oryza rufipogonEragrostis curvula6.1824.0395.1662forward
CNT30724273Oryza rufipogonLupinus angustifolius13.9424.3181.43140forward

Expression of CNT30103353

Peptides detected in this lncRNA

>peptide 1 (83 aa)
MSASASADSSSSMLRPSLSIRWILVPKVLGSSRLKPEVRRAVSKSSITRSFTDLSFLSASARLRSSSMMEFSGLISMVFLLDM*

>peptide 2 (40 aa)
MTTMALSRPPPSCSRRRRPPAAACRRQPQQTRPRRCSGRA*

Sequence

>CNT30103353
AAAAGGCCCATTCAAGCTAAGAACAAAGTGGAGATAATGCAGAACAAAGAGTTACTATAAAAGGGCTAATGCAGAATAAGAAAATACAGATTCTGGATTA
ATTAACTAGCATATTTAAATTTAAAACGTAACTGTTTGAGCAAATACCACGAAATGTTCAGGCGCTAAGATACGGCAATACCGATACATCCAGCATAGCA
AAAATGGCGAAGAGCACAGAGTCAGATAAAGCTATAGAGAACTAGGGCTCCAGGAGATGGGGGCCGAATGACAACCATGGCGCTTAGTCGACCTCCTCCA
TCTTGCTCTCGCCGGCGTCGTCCTCCAGCGGCGGCATGTCGGCGTCAGCCTCAGCAGACTCGTCCTCGTCGATGCTCAGGCCGAGCTTGAGCATCCGGTG
GATCCTGGTGCCGAAGGTGTTGGGGTCCTCAAGGCTGAAGCCGGAGGTCAGGAGGGCAGTCTCGAAGAGCAGCATCACCAGGTCCTTCACAGACTTGTCG
TTCTTGTCAGCATCGGCACGCTTGCGGAGCTCGTCCATGATGGAATTCTCCGGGTTGATCTCCATGGTCTTCTTGCTCGACATGTAGCCGGCCATGCTGG
AGTCCCTCAGAGCCTGGGCCTTCATGATCCTCTCCATGTTAGCATCCAGCCATACTCCCCAGTGACTAGACAGCAGGGAGAGTCCACCACACGGTCAGAG
ACGACAACCTTCTCCACCTTGTCACCGAGCACCTCCTTGATCACCTTGCACAGACCCTCGAACTTCTCCTTGAGTTCCTCCTGCCGCTTCTTCTCGTCCT
CACTCTCATCAAGCTTCAGACCTTCCTTGGTGGCAGAGACGAGCTTCTTGCCTTCAAACTCCTTAAGCTGACCAACAGCGTACTCATCAATGGCATCAAC
CATGTACAGGACCTCATAACCCTTCTTCTTCAGCTTCTCAAGGAAGGGGGAGTTCTCAACAGCCTTCTTGCTCTCACCAGTGATGTAATAGATCTCACTC
TGGC