Detailed information on CNT30103334


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30300982Oryza rufipogonTriticum aestivum20.4660.0589.73224forward
CNT30105192Oryza rufipogonOryza longistaminata27.472.8288.33300forward

Expression of CNT30103334

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MIGPISWKKKPQETTRGECSQAKVKSQSCWTSATQRIV*

>peptide 2 (36 aa)
MPRGCGRRRGRMRRRCRRRGTTAPGTASPPSESTTA*

>peptide 3 (35 aa)
STARRIQKGPSRIKNKEHTLPTNIFRPLSNKPNCI*

Sequence

>CNT30103334
TTCCACTGCAAGAAGGATCCAAAAAGGACCATCTAGGATAAAAAACAAAGAACACACCCTACCTACAAATATTTTTCGACCACTTTCTAACAAACCAAAC
TGTATCTAGCACAGAATTCAAATGATCGGCCCCATCTCATGGAAGAAAAAACCACAAGAAACAACAAGAGGAGAATGCTCTCAAGCTAAAGTTAAAAGTC
AATCGTGTTGGACATCTGCAACACAAAGAATCGTCTAGGATCTGACCTATACCATCGATCTCTACCAAACGTACAAAAAGGTAGCAACATTTCAAAGCTT
GACATATAGACAATTAGATAAAGGTTTATGTATACATCCTGCAACAGAAAGACCATTAGGAGACATCGAACATGCATGTACAGCACACAAAGTACATAAA
GACACCTTCTTTTTTTTTGCTAGCTGCTCACGGATTAAAAAGCAACCCTACATAACTTACAACTCCGGCAAATTAAAAGTCGATCTCTCTAGCAACGCAC
AAATGCACACGGCTACACATACCGGAATAATTAATATACTGTATAATAATAATAATAATAATAATAATCGAACTATCAGCTAAGATCGATCGGTGTGCAT
AAACACGCGGAAATACGGTTCGGTCGGTCGGTCGGTGTTCGCCATGCACGCAACCGTCGCATGCAACACAAAATGCAATATAGAGATTTAGGATAAAACT
CGAGCGAGAGCTAAGGTAGAGCTACTCTATGGAGTAGCAGCTCTGCTTGAATGCCTCGAGGTTGTGGTCGAAGACGGGGACGAATGCGTCGACGCTGCCG
TCGCCGAGGTACGACGGCACCAGGAACAGCATCCCCTCCGTCGGAAAGTACGACGGCATGAAGTAGGTCGGGCTGCCGGTGCCGAAGTCGAGCTCGTAGA
ACGGGAAGGTGAGCCAGCTGTCCACCTCGGCGTTCGGGCACAGCACGTCCTTGAGCACGGCGCTCGGCGCGAGCCCCTCCTTGTCGCCGCCGGCGCCGGA
GAGGGCGAAGTCGAGGAAGGAGCGGAAGTAGGCGCCGTCGACGCGCGCCACCTCGTCGTGGATCACCTGCGCGGCGTGCTTGAGCGGCCGGGTGA