Detailed information on CNT30103304


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONZMAT001559, E-value = 3e-31

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30108377Oryza rufipogonOryza longistaminata86.6486.5797.114325forward
CNT30117508Oryza rufipogonOryza nivara52.88100.0499.582640forward

Expression of CNT30103304

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MDIVGSTSNLSSNNSIQYFWVQQSIIFLTKWDIKLWVAIDACGIMRDRLS*

>peptide 2 (47 aa)
MYIIKEPFVMKMIFTCQALHNMKLHGSHVLMFVTTLLLNSVRKPSME*

>peptide 3 (42 aa)
MYMFTSVGGTSLLCTTDLCFANEVATCILSLTMQCKKTPVLM*

>peptide 4 (38 aa)
MVIAMKFQVINSNLWESVQVKSLLFTAADYHDATALIS*

>peptide 5 (34 aa)
MILMLLLTKLSLAKVHIWQTNHLTLVSLASVNHS*

>peptide 6 (34 aa)
MPFMSHSCFLIFLVLQIKQYRTRSIIFLKETKVL*

>peptide 7 (30 aa)
MIELPTKSLFCLQLHDHFLLASCVLHFCAG*

>peptide 8 (29 aa)
MDFMSISLKCFENVSDGINLQIISFHSTS*

>peptide 9 (78 aa)
KKKKRRKNSRLVSAPASSPTACADFHLPSEQSRSRNRGAVVLLLQPHPGCCVSVSVVMGKNVKVKAKNLGIQLSEWAV*

>peptide 10 (71 aa)
MIIDFTGSLLKFQRTYIFYGISFYSYSWCIICVLSLCFLRHSRKTCEYIYFFTSSSSIVESTQYGHCWQHK*

>peptide 11 (55 aa)
KKRKEEKTPVSSPLQRVRPPPAPISISRASRAGAGTGAPSSCCFSHIPVVVSRYQ*

>peptide 12 (59 aa)
MYSGSEGCGPFLCSLYYCHNAGLSFLCSPIHCKMHSISSNVYHQRTFCDENDIYLSSTS*

>peptide 13 (50 aa)
MFSGLRKYDLVFTICMLLKKLALKKDFVNAFYVTFMFLNIPCFTNKAIQN*

>peptide 14 (52 aa)
MYRGCKFSVCNLLNQHCTYELVRRKKNGFNTPTKSSLQMNTNLRCHVLMLVV*

>peptide 15 (60 aa)
MLMLGKVCDGKDFAFFNMYECIWMTKSQFYSSNMEQPNLKGPTSTGTRSLMHQFIECALR*

>peptide 16 (49 aa)
MPYASTDLFVSVRQQNTIANSVLLESDANTNKKKHSSTNHDNDQLGVTE*

>peptide 17 (40 aa)
MNSGLVSSLLLGRFLCNFSIPAHCPNRLLIFFINFTNSLCE

>peptide 18 (87 aa)
KKEKKKKLPSRLRSSEFAHRLRRFPSPERAEQEQEQGRRRPAASATSRLLCLGISSDGEECEGEGQEPWDSAFRMGGLTALKSHNYF*

Sequence

>CNT30103304
AAAAAAAAGAAAAGAAGAAAAAACTCCCGTCTCGTCTCCGCTCCAGCGAGTTCGCCCACCGCCTGCGCCGATTTCCATCTCCCGAGCGAGCAGAGCAGGA
GCAGGAACAGGGGCGCCGTCGTCCTGCTGCTTCAGCCACATCCCGGTTGTTGTGTCTCGGTATCAGTAGTGATGGGGAAGAATGTGAAGGTGAAGGCCAA
GAACCTTGGGATTCAGCTTTCCGAATGGGCGGTTTAACGGCTCTCAAATCACATAATTATTTTTAGTTCAGAAACAGAAATGTTTGAAGTACAGGTATTA
GCCTAGTTGAGCAATTATTTTGAACAGCATCCTATGATATTGATGCTGTTGCTAACAAAATTGTCGTTAGCGAAAGTTCATATCTGGCAAACCAACCATT
TGACATTAGTTAGTTTGGCTTCAGTGAATCATTCATAACTTGTGAAGCACTTCATTTGCTGGAGGAAAGTACACTGGAGCTTTCTACCACCCTCTGTTTT
TCTCCACAGCCAAAAAAATTACAATTCTTTCAATGCATGGATATGTTTCTTTGAAAACGCACACCTAAAAGGCGGTCAGGATGTTACATTTCCAGCTGAC
CTCTTTGGATGATAGGAATGCTTGCAAAGTTGATTCAAACTGACATAGACGATAACATGACCAGGAATGGATTTTATGAGCATTTCACTTAAATGTTTTG
AAAATGTGTCTGATGGCATTAATCTGCAGATTATTTCCTTTCATTCAACATCATGAACTGTTTTTCCCAGCCATCTGAAATTTTAGAACACAGGAAGCTA
CTATAATTTTGTGTTTTCCCTGAACGTGAGAAGTTAATGGTGGTTGAGTACAAGAAATAAGTTTTAACTAACACAGTAAAGATGTAGTGTTATAAAACTG
GAAAAACTATTTGTTACTACAGTTTTGAAAGGTAGCTTCTACCTCCCTCATCTAATTTATGTTTTATTAATCTGAAAAGATTAACAGGCTGCAAACTTCA
AAGATCATGTTCACATTGCTGTATCCATCGTAATCAGTAGTGTCTCTGTAGAAGCGTAGAGTTACAGATGATCGCAGACGTTGAACTATATTATAGATGG
AGGCTTAACGTATAATCCTTTTACTTAATCCAACATGATGCTGCCATGAAGATGGAAAATTTTATTTGTAGATGACAAGCAGGAAGATATCATGATAGGT
AACTGATCGTAATATTTTTTCTTTTGGTGACAGGTGGAGTTGTAGAGTGTATTTTCCGTGTATATTAAAGAAACATATCACTGTAACAAAGTGCTAGCTT
GCTTGTCTCCGATGCTTCTAGGCCTCTAGCAACAGATGGCATTTTACAAAGATATGCCTAGATCTCATTACTAAGCACATACTCCCTCCGTCCCAAAATA
TAGTTGCCTTTGTAGTTCAAACAAAGGTACAAAGGTAGCTATATTTCGGGACAGAAGGAGTAGTACAGTAAGGACAAGGAAACCGGTTTCCTTTCCTACC
AATACCCAATTTTGGCATTCTGAACTATTTTCAGCTAATCAAATGGTTCTTTCTTCTGTTCAAACAAGAAGAAACAGGTACTCCTGCTACTGACTGGGAT
AAAATTTGAAGCCTTAATGGTAATCGCTATGAAGTTCCAAGTTATTAATTCTAATCTCTGGGAAAGTGTTCAAGTAAAGAGCCTACTTTTTACTGCTGCA
GATTATCATGATGCCACAGCATTGATATCATGATTGTTACCTACATCTTTCTACTGTTATGTATAGAGGTTGTAAATTCTCTGTATGTAATTTGCTAAAT
CAACACTGTACTTATGAGTTAGTCAGAAGGAAAAAAAATGGATTTAATACACCAACAAAAAGTAGCCTGCAAATGAATACTAATTTGAGGTGCCATGTAC
TCATGTTAGTGGTCTAATGATTGAGTTGCCAACTAAATCTCTATTCTGTCTTCAGCTTCATGATCACTTCTTGCTAGCTAGCTGTGTACTGCACTTCTGT
GCTGGGTAATCTGGAGACAGCATTTTGGTTTGTCTAGAGGGTGAGGTGCAGATTTACAGCAAAGACTCACTTCCTAATAAGGTAATATGTACATGTTTAC
TTCTGTTGGTGGAACCAGTTTGTTATGCACAACTGATTTATGCTTTGCCAATGAAGTAGCAACCTGTATTCTTTCCCTAACAATGCAGTGCAAGAAAACA
CCTGTGTTAATGTAGGTTGTTGAATTGACGTTATAACTAAAGCTGGATATGGAGTTATGATTGTTGCTGCAGCCCAGAGTTTGTTCTTCTATGTTTGATG
TTCTAGTATACTAGTTGGTCAAGTAATTTATTTTTCTACTTTTGCTCCAAGATAGGTAATCAAATTTCTTTGATTAAGTGCTAGGTCCCTGGTTCCAGAC
AAGAAAATGCATATAATGTGATAATTCACCTGTTCTGGGATTACTACCAGATTTAAACTTTTTGACAAGTGAACTAGAATGTCGCCTTGATTAGATGTGA
TCTGATTCTGCAGTGGTTTAAAATAGATAGAGTATTCCATTTTGTTCTGATGTTTTCTGGGCTCAGAAAATATGATCTTGTTTTCACAATTTGCATGCTC
TTAAAAAAACTTGCGCTGAAGAAGGATTTTGTGAATGCCTTTTATGTCACATTCATGTTTCTTAATATTCCTTGTTTTACAAATAAAGCAATACAGAACT
AGGAGCATTATATTTCTAAAAGAAACAAAAGTATTATGAAGCTTGTGGCTAGAAAAAATGGAATGCTATTTCAAACTAATGCAAAACAAAGATTGGTGTT
AAAGTTCCTTTTCTAATTAAGAGAAGAGGGTCGGTGTCTACTCGTTCAGAAATTATAATTAAGTTTGTACTCTCTTTTCTAGAGCTTGATTTTTTTTTTC
TCTTGTGAACTATAAATGTTATGGACTAAAGCATCTCCTGCATGTGTCCCATGTGAAGCACTGCAGTTGAGAATGTGATGAAAAATCTAATAAATTAGGA
GAAAACTTTTATTTCTTTGCTGACACGCATATTATTCAATGGTATTATCCAAGGGAGAGAAGTGCACAGCACAACCCAAATGACTCATCTATTGATAATG
AAGGTTTGTCCCCTTTATGCTCCCTGGTTTACTGCAATAATGTAGATTTATCCCTTATATGCTCCCCAATTTAATCCAAATGACTCATGTATTCTGGTAG
TGAAGGTTGTGGTCCCTTTTTGTGCTCCCTGTATTACTGCCATAATGCAGGTTTGTCTTTCTTATGCTCCCCGATTCACTGCAAAATGCACAGCATAAGT
TCCAATGTATATCATCAAAGAACCTTTTGTGATGAAAATGATATTTACTTGTCAAGCACTTCATAATATGAAATTGCATGGCAGTCATGTACTCATGTTT
GTGACCACATTATTATTAAACTCCGTGCGCAAGCCGTCCATGGAGTAAAACAAAAAGTAGGAACGGGCTTCATTTGTGCTCTTTGAAGTTGAACAGATCA
ATCACACATCACTGATACGTGAGAGAGATTGACCCGTAACTACTCTGGGTGACTGATTGATAGAATCGCGTCAATTTGGGTTACTGATAAACTTGCAAAA
TCATTAACGTCAGCGTCCAAACAACGACCAGATCAGAGTAACCATTGCCATCAAAGTTGTTTGTAAGAAGCTTAGGCACGCAATCGCTTGTTGTCGACAT
CCTTACTCCACTGCCAAGATTTGTTAGCTAAGTATTCATATATGCACACAGAAACTAACAGAGATATAAAATTATGAAATTCACATTGGCTAGCCATTTG
GAAGTTTCAATGTGGAGTATCTAGTTTTCTTCTGGATGAATGCATCACAGGGGTAGCTTTCATGATTATTGATTTTACAGGATCATTACTGAAGTTCCAG
AGAACATATATTTTTTATGGCATCTCTTTCTATTCGTATTCCTGGTGTATTATTTGTGTACTTTCTCTTTGCTTTTTAAGACATTCAAGGAAAACGTGTG
AGTATATATATTTTTTCACATCTAGCAGTAGCATAGTAGAGAGTACTCAATATGGACATTGTTGGCAGCACAAGTAACCTGTCTAGCAATAATTCAATTC
AGTACTTCTGGGTTCAGCAATCAATCATTTTTCTTACCAAATGGGACATAAAATTATGGGTGGCAATAGATGCCTGTGGAATAATGCGAGATAGACTATC
TTAGTTAAACATTGGGAGTTGGAGAAAAGAAAGGGAGAAGGGTAAATAAACTACCTAGACATACCAATACATCTTCCTCATTTAGAGTTTCTCTCAACCT
GACATGCATATAAAATTTTGTTTCTTTATCGTTTTTATTTTTAGGCATCATCTACTAATTTATTTATATCATTTTTGAACCTCTGTTACTTTCTTGACGT
TCGCAGTAATTGTTTGTTCATGCTAATGCTAGGAAAAGTATGTGATGGAAAAGATTTTGCCTTCTTTAACATGTATGAATGCATTTGGATGACTAAATCA
CAGTTTTATTCTTCAAACATGGAGCAGCCTAATCTGAAGGGTCCTACTTCTACAGGTACAAGGTCCTTGATGCATCAGTTCATTGAATGTGCTCTTAGGT
GAGAAAAAGCATGCCATATGCCAGTACGGATCTTTTTGTGTCTGTTAGACAACAAAATACCATTGCCAATTCGGTTTTGTTAGAGAGCGATGCCAATACA
AACAAGAAAAAGCATTCGTCTACCAACCATGACAATGATCAATTGGGTGTGACTGAGTGAGCAACAAGCTATATTCTCCAGGCCTCCAGACTTCAGCAAA
ACACAGACCAGGGCTTCCTGATTTCCATTAGTTAGGTTATCAAATGTGTTAAGAGCAGAGAACTACAAATGAATTCTGGCCTTGTCAGTTCCCTTCTTTT
GGGCCGATTCTTGTGCAATTTCAGTATTCCTGCACATTGTCCAAACAGACTATTGATTTTTTTCATTAATTTTACAAACAGTTTATGTGAGC