Detailed information on CNT30103248


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0JC44|CML22_ORYSJ, E-value = 2e-17

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30441165Oryza rufipogonAegilops tauschii26.3736.6287.05193forward
CNT30117502Oryza rufipogonOryza nivara24.0441.1299.43176forward

Expression of CNT30103248

Peptides detected in this lncRNA

>peptide 1 (74 aa)
MRWHSAWPAPAANPSEASTLPSSPASMKPSPLRSKTRNAAAASPRVAKNRVQVNRRRRRHRGRCSGAAPGRRTR*

>peptide 2 (41 aa)
MIQTAPKLIISIHMLPFFIRLSDRSRLKRKIERKNKEFAEK*

Sequence

>CNT30103248
GCACGGAAATTGTCATTTCAATTCGATTTCCATCGATTTCAGTTCAAGTAAAACACAACCCGTTTCTTGGCTCTTTGTAATGCCATGATCCAAACAGCAC
CTAAACTGATCATAAGCATACACATGCTGCCGTTCTTCATTCGGCTGAGCGATCGAAGTCGATTAAAGAGAAAAATAGAACGAAAGAACAAAGAATTTGC
AGAGAAGTGACGCCATGGGAATCCTGTGGATTCCCTAGGCCGCAGCCGTCTCCATGAACTTGAGGAACTCGCGGAAATCGACCCTGCCGTCCTTGTCCGC
GTCGTAGGCGTCGATCATGCGCTGGCACTCGGCGTGGCCGGCGCCGGCGGCGAACCCGAGCGAGGCGAGCACGCTCCCGAGCTCGCCGGCGTCGATGAAG
CCGTCGCCGTTGCGGTCGAAGACGCGGAACGCCGCCGCGGCCTCCCCCAGGGTGGCCAAGAACCGTGTCCAGGTCAACCGCCGCCGGCGGCGCCACCGCG
GGCGCTGCAGCGGCGCGGCGCCGGGAAGACGAACTCGATGAGGAGGAGGAGGAGGATTTGACGAGGGCGGAGAGGCCGATGGCGATGACGTTGAGGGAGA
TGGTGAGCACGGCCTGCGCCATGGAGAAGTGGAACGAGTAGGTCGACGACGTGCTCGGCGCCGAATACGCTGCCTCCATGGCCAAATAAATCAGTTGCTT
CCGTCCGCTTCTCTTCTCTCGAGAGATTGTCT