Detailed information on CNT30103219


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30363020Oryza rufipogonSorghum bicolor15.5324.1989.05201forward

Expression of CNT30103219

Peptides detected in this lncRNA

>peptide 1 (64 aa)
MASSRREEGGRGRVSLSSQLGLSPLRQLTFLRSRADDTVTSTSYRDPISSDPLTRSTTLCLLAS*

>peptide 2 (70 aa)
MKMKIINSRRRSRRRRSRRLCRDRPPPSPPRPPRTCPPGSWRRRPALALPARPPPRPPPALSPSPSCSSS*

>peptide 3 (44 aa)
MSKSTLDRSDINIVHQHLSFLARRKILFSPLNEREEMNNTSSSA*

>peptide 4 (49 aa)
NFFNKKNGQTYLKSQHRQISRNRGSIFLTIPHRQTIVQECPNPHWIGLI*

Sequence

>CNT30103219
AATTTTTTTAATAAGAAGAACGGTCAAACATATTTAAAAAGTCAACATCGTCAAATATCTAGAAACCGTGGAAGTATTTTTCTGACAATTCCACACCGAC
AGACGATAGTACAGGAATGTCCAAATCCACACTGGATCGGTCTGATATAAATATTGTTCATCAACATCTCTCTTTCTTGGCGAGGAGAAAGATTCTTTTT
TCCCCCTTGAATGAAAGGGAAGAAATGAACAACACATCATCATCAGCATGAATAATGAGTTGTTTTTTAAACCAAAAATTGATTATTGCTACTCTTGTTT
AATTTGTGTTTCTCAATTATTGTAGTAGTATTGTATCATATGAAAAGAGGTAATACTAGTAAGTATAGGTATTATTATTGGGTTATATTAGGATGAGTTT
GAAGTGCAGGGATAGGCGTGGTGTGGATGAATCAGAATGAAAATGAAAATAATTAATAGTCGTCGTCGTAGCCGCCGGCGCCGTAGTCGTCGTCTCTGTC
GAGATCGTCCTCCACCTTCTCCGCCACGCCCTCCTCGAACTTGTCCTCCAGGTAGCTGGCGCCGCCGGCCAGCGCTAGCCCTCCCAGCACGCCCGCCGCC
GCGCCCACCGCCAGCCCTGTCCCCATCCCCATCTTGCTCTTCTTCTTAGTCTCCTCCACAACCACCGGAGGCGCGCCGCCGTACGCTGGCTGTGGCGGCG
CCCCGTAGGCGCTCGGGTACCCTGCCGGCGGCGCCGCGTACCCGCCTGAGCCGTAGCCACCACCGTACGGGTACTGCCCACCTGAGCCGGAGCCGTAGGG
CGAGGGGTCGTAGTAGCGCGCGGACTCGCGGACGGCGAGGCGGAGGTCGAGGCGTCCCTGGGGGCGGCCGGAGGGGCGCTTGAGGCGGAGGGAGCGGGAG
ACGCGGGCGCCTACGCCGGCGTCGTCGAGAACGTCGCGGAGCGGGAGGCGGGCGGAGCCGACGAGCGGCTTGACGCCCTCGGCGGCGTTGGCGTGGACGA
CGTCGACGTAGAGGATGGCGTCTTCGAGGCGGGAGGAGGGGGGGAGAGGGAGGGTGAGCTTGTCGTCCCAGTTGGGGTTGTCGCCGTTGCGCCAGTTGAC
GTTCTTGAGATCCCGCGCCGACGACACCGTCACCTCCACCTCGTACCGCGACCCCATATCCTCCGATCCGCTCACTCGATCTACTACTCTCTGCTTGCTT
GCTTCCTAGCTATTCGATCACCTGCCCTGATAGTGTGTGTGATAGATGATGATGATGATGTTGTTCTACTCTTGTGTCAAGAAGAAGAATAAAA