Detailed information on CNT30103210


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT007306, E-value = 5e-123

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697065Oryza rufipogonOryza sativa99.1732.1497.49358forward
CNT30554953Oryza rufipogonOryza glaberrima93.0727.2994.05336forward
CNT30116840Oryza rufipogonOryza nivara70.3668.198.43254forward
CNT30604527Oryza rufipogonOryza punctata83.9396.1988.45303forward

Expression of CNT30103210

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MDLYIKLSVCVPRLIPGPGFYAQISSEITSEFPGVTR

Sequence

>CNT30103210
CTTTTTCTTCGTTTTGCGTGTTAGCTTGTCGTTTCCGTGGTTGCGAAGGTTCGTGAGTGCGTCGGAAGTGATCAAGAAGATTAATTGAAGATCGATTATT
GCAAGTTGAAGAAAAAGGATCCAGAAGGAGAAGACGTTTGGCTTATACCCCAGTTGAGCTGCCTGTGGGAGTGGAGCTGAAGCCATCGCTAGACCGTTAA
TTCCGCTGCTGTTTTCTTTTCTTTTGTAAGTATGTAACGTTATTATTAAGATGGATTTGTATATTAAATTGTCAGTTTGTGTACCTCGGCTGATTCCTGG
ACCAGGATTTTATGCACAAATTAGTTCGGAAATTACTAGTGAATTTCCGGGCGTGACACGC