Detailed information on CNT30103075


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006746, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30596716Oryza rufipogonOryza meridionalis27.240.1696.08306reverse complement

Expression of CNT30103075

Peptides detected in this lncRNA

>peptide 1 (66 aa)
PPPRARFDLCLKSLIWAVGCSSELLELHLMIAHNKDGICNPNLPRSTSSRQALSLCTQSLIHVFCT*

>peptide 2 (33 aa)
MFSCLLQAYLIILQDQPSPSEIFKSPPFSSIHH*

>peptide 3 (32 aa)
MGSSEKNVCSMIYIDSLHFWGYSIELVMKIKA*

Sequence

>CNT30103075
CCCCCCCCCCCGCGCGCGATTTGATTTATGCCTGAAAAGTCTGATTTGGGCCGTTGGTTGTTCTTCAGAATTGTTGGAGTTGCATCTCATGATAGCACAT
AACAAAGATGGAATTTGCAACCCAAACCTGCCTCGGTCTACGAGCTCAAGACAGGCTTTATCCCTATGCACTCAATCTTTAATTCATGTTTTCTGTACTT
AGGCTACTTTCTTCCAAAATAATATTCTTGCTCTCTGTAGGTCTCTGAATAGGAGTAATTTTTTTATGGCCCGTCTCAGTGAAGCACACCACCATTTTCT
CTTCAATTCGTCATTAGAAGTTAAATACTTACAAAGTTGAATTTCTTCCCAAATAAATGTTCTCTTGCTTATTGCAGGCCTATCTCATAATTTTGCAAGA
CCAACCTTCACCGAGTGAAATCTTTAAATCACCGCCATTCTCTTCAATTCATCATTAGAAGTTAAATACCTCACAAAGATATATTTAAATCCAATCTATT
ACTCACTACAGGGAAGCTATGAAATTATGAGAAGTAGCATGCCTAAGTTGACTCTCTTCTGCTTGATATGATGTCCTGAACATGCATTGTTCAGGTGAGC
ATAGTTATCTATATTGAGATCCCTTCCGCATCGTGATCGCGTCCGGCCCACACCCCGGTCATGGCCATTCTGTCCTCTAAACCTTCCAGATAAACAATTT
AACAGGAGCAAAACAGCTTTGTTCGAAGGACTCAATGCTAGGAATAGCATGGGGTTAAGGCATTGAATATTCCTCTCCCATGCTCTGGACCGTTTTTCTG
TTGGCGGTCTAAGTCAGGCATTGCTCCAGTATTAGCTTTTGGATGGCTTTAATTTTATTTTGTGAAATTTGAATCTGATAAAAGTACATGAATAAAAACT
TATGTTATTTCTTATTTCATCATTGTAAACTATGAGATCAATCTAGCCCCAGGAGGTGTTTGACAATATTTGAATGTTTATTGAATCAACTACCTCTTGG
ATATGGGATCGTCTGAGAAAAATGTGTGTTCAATGATCTATATAGATTCTCTCCACTTCTGGGGCTACAGTATTGAGCTTGTTATGAAAATCAAAGCTTG
AATTTCCATAAAGAATCATAAAAAA