Detailed information on CNT30103073


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9ZT94|POLR2_ARATH, E-value = 1e-07

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695714Oryza rufipogonOryza sativa97.8698.82100502forward
CNT30523266Oryza rufipogonSetaria italica4637.8286.44236forward
CNT30554770Oryza rufipogonOryza glaberrima53.88098.19276forward
CNT30109102Oryza rufipogonOryza longistaminata10078.3299.81513forward
CNT30117494Oryza rufipogonOryza nivara10079.9199.22513forward

Expression of CNT30103073

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MRSWLGALHVCVNIRGCWSIRRWANGCFWDFRQIQ*

>peptide 2 (91 aa)
MAGSLACLRIHEKLVGSLACLRIHEKLAGSFARVCQYQGLLEYQKVGEWLLLGLQANPMTLNQYQTHSLHQDVRQHLQLVFPHVSPLEEEV*

>peptide 3 (32 aa)
MKAALAVGFSSKSLGFENSCEANWELLMFENS*

Sequence

>CNT30103073
AGCAAATGGCGGTGGAGAGGCAAATGGAACAAAATGTTTCTTTTCATTGGGTGAAACTGGCATACTTGGTTGAGCGAATGGTGTAGGAATATGTTCTGAA
CCTTTTGGCTGAGTCATGAAAGCAGCATTAGCTGTTGGATTCTCTTCCAAGTCACTTGGGTTTGAGAATTCATGCGAAGCCAACTGGGAGCTTTTAATGT
TTGAGAATTCATGAGAAGATGGCTGGGAGCTTGGCATGTTTAAGAATTCATGAGAAGTTGGTTGGGAGCTTGGCATGTTTGAGAATTCATGAGAAGTTGG
CTGGGAGCTTTGCACGTGTGTGTCAATATCAGGGGTTGCTGGAGTATCAGAAGGTGGGCGAATGGCTGCTTTTGGGACTTCAGGCAAATCCAATGACTCT
AAACCAGTATCAGACTCATAGTCTTCATCAGGATGTTCGGCAGCACTTGCAGCTAGTGTTTCCTCATGTTTCTCCTTTGGAAGAGGAAGTGTAGAACCAT
TGAAGTAGGTTGG